DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN9A and unc-77

DIOPT Version :8

Sequence 1:NP_001352465.1 Gene:SCN9A / 6335 HGNCID:10597 Length:1988 Species:Homo sapiens
Sequence 2:NP_001293824.1 Gene:unc-77 / 177379 WormBaseID:WBGene00006809 Length:1867 Species:Caenorhabditis elegans

Alignment Length:2059 Identity:375/2060 (18%)
Similarity:745/2060 (36%) Gaps:653/2060 (32%)


Human   128 FSMLIMCTI--LTNCI--------FMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGEFT 182
            :::.|.|||  :|.||        |..:|.   .....::....|:..:|:::|...|....:.:
 Worm    88 WALKIACTISMITVCIHTPRTIELFQPLNY---IILAADFISVSIFMLDSVLRIHYEGIFRCDSS 149

Human   183 FLRDPWNWLD-FVVIV------------------FAYLTEFVNLGNVSALRTFRVLRALKTISVI 228
            :|.:.|:... |:.|:                  |.:|......|.:.::|.|.::|.:..:...
 Worm   150 YLSNRWSQFSVFISIIHLLSFLLHCYQLIDNFFPFLHLNYRAWYGAIRSIRPFIIIRLIPLVVKF 214

Human   229 PGLKTIVGALI-QSVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLE-NNETLE--SI 289
            ...|..:..|: :|.:::.:|.:..||.::::|:.|:||| |.:.:.|.:...: ||.|:.  :|
 Worm   215 KLPKNRIEQLLKRSSQQVKNVTLFFVFFMTLYAIFGIQLF-GRMDYHCVQPKTDPNNVTIMDLAI 278

Human   290 MNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNP--DYGYTSFDTFSWAFL 352
            .:|:.:.|....|                    :||....|:::..|.  :..|..|:.|..:..
 Worm   279 PDTMCAPEGIGGY--------------------ECPAPMVCMQLNLNAKGEGFYGMFNDFGASVF 323

Human   353 ALFRLMTQDYWENLYQQTLRAAGKTYM--IFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEE 415
            .::...:::.|..:....:.:. .:|:  ::|..:||..::.:.|:.:||:...:.|        
 Worm   324 TVYLAASEEGWVYVLYDCMDSL-PSYLAFLYFCTLIFFLAWLVKNVFIAVITETFAE-------- 379

Human   416 AKQKELEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRNRR 480
               ..::|.:|.                                                     
 Worm   380 ---IRVQFSEMW----------------------------------------------------- 388

Human   481 KKKNQKKLSSGEEKGDAEKLSKSESEDSIRRKSFHLGVEGHRRAHEKRLSTPNQSPLSIRGSLFS 545
                |||..:.:| |..:||.|::                                         
 Worm   389 ----QKKEVTLDE-GFRKKLEKTD----------------------------------------- 407

Human   546 ARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRRGSLFVPHRPQERRSSNISQASRSPP 610
                                                                             
 Worm   408 ----------------------------------------------------------------- 407

Human   611 MLPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKATSDDSGTTNQIHKKRRCSSYLL 675
                                 ||...:.| :|::.||                            
 Worm   408 ---------------------DGWRLIRL-DGEVEPE---------------------------- 422

Human   676 SEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHKFLIWNCSPYWIKFKKCIYFI 740
                  .|..:.:.|.|:                                           :|| 
 Worm   423 ------GPKQKLQWMLRS-------------------------------------------MYF- 437

Human   741 VMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGNLVFTGIFAAEMVLKLIAMDPYEYFQ 805
              ..||.:.:.|..:.|.:|: ..|....:..|....:..:.||.:|..|.::|::......:.:
 Worm   438 --QCFVIIFVVINAIGNAMFV-YRHDETDKPRKYNFYLFEVGFTILFNVECIIKILCYGFRNFIR 499

Human   806 VGWNIFDSLIV---TLSLVELFLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALG 867
            .|...|:.::.   :|:.|:.|. :....:..::|||||   |.|:.|.|...:..|.:....||
 Worm   500 RGIFKFELILCLGSSLNCVKFFY-ERNYFTYFQTFRLLR---LIKASPILEDFVWKIFSPGKKLG 560

Human   868 NLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINDDCTLPR-WHMNDFFHSFLIVFRVLCGE-WIE 930
            .|.:.....:..::.:.:|||              .::|. .|...|..:|:.:|:::..| |.:
 Worm   561 GLVIFTIAFICCYSAISLQLF--------------YSVPNLHHFRTFPQAFMSMFQIITQEGWTD 611

Human   931 TMWDCMEVAGQ------AMCLIVYMMVMVIGNLVVLNLFLALLLSSFSSDNLTAIEEDPDANNLQ 989
            .:.:.:.....      |:..:.|.:.:   .|:||:||:|::|     |||...||......| 
 Worm   612 FVVEVLRATDDNLVPLVALYFVAYHLFV---TLIVLSLFVAVIL-----DNLEMDEELKKVKQL- 667

Human   990 IAVTRIKKGINYVKQTL--REFILKAFSKKPKISREIRQAEDLNTKK------ENYISNHTLAE- 1045
                |.::....::.||  |..:.:.|..:|:::...:...|....|      ..:..:|:|.. 
 Worm   668 ----RAREATTSMRSTLPWRLRVFEKFPTRPQMAAMRKADSDFPMPKVRGSFTHQFAVDHSLETT 728

Human  1046 --MSKGHNFLKE------KDKISGFGSSVDK-----------HLMEDSD--------GQSFIHNP 1083
              :.....|.|.      |.|||..|.:..:           :|:|.||        ..||:  |
 Worm   729 DVIESDFEFPKRIMKSAGKRKISKSGLTFRQIGSTSLRCSLNNLLEMSDRTRQSLSNSLSFL--P 791

Human  1084 SLT-VTVPIAPGESDLE-------------------NMNAE--ELSSDSDSEYSKVRLNRSSSSE 1126
            ..| .:..:.|.:..|.                   ||.:|  :||..|||...|       :::
 Worm   792 HFTRSSGSLYPRKDALPKSRSMTGKFLQTAVRNKQFNMYSENGDLSRPSDSAPKK-------NAK 849

Human  1127 CSTVD-NPLPGEGEEAE------AEPMNSDEPEACFTDG---CVWRFSCCQVNIESGKGKIWWNI 1181
            ...:| ..|..:.:.||      .|.|..:.|   |.|.   .|.|.|               .:
 Worm   850 QGEIDIRALQQKRQLAEITRNRIEEDMRENHP---FFDRPLFLVGRAS---------------QL 896

Human  1182 RKTCYKIVEHSWFESFIVLMILLSSGALAFEDIYIERKKTIKII--LEYADKIFTYIFILEMLLK 1244
            |:.|.|:| ||.::|    ....::|....:..:.|.:..|.|:  :::|....|.:..:.||.:
 Worm   897 REFCKKMV-HSKYDS----QDDGTNGGAKTKKRFKEIRALIGIMPYIDWAMATVTIVSCISMLFE 956

Human  1245 --WIAYGYKTYFTNAWCWLD--FLIVDVSL---VTLVANTLGYS------DLGPIKS-------- 1288
              |...|......|.:..:.  |.::.::.   |.::||.|.::      |:|.:.:        
 Worm   957 SPWPTTGENLVMNNGYLQISDYFFVLSMTFELCVKIIANGLFFTPKAVVRDVGGVMNLFIYFTSV 1021

Human  1289 ------------------LRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIF 1335
                              |...||:||||..:....:|.||.........|:.|.::.::...||
 Worm  1022 IFLAWMPKHVEINSLAQFLMICRAMRPLRIYTLVPHIRRVVLEFFRGFKEILLVTILMIVVMFIF 1086

Human  1336 SIMGVNLFAGKFYECINTTDGSR------FPASQVPNRSECFALMNVSQNVR------WKNLK-V 1387
            :..||.:..||...|.:.|..||      |.......|.|.:.....:.:.:      |.|.: .
 Worm  1087 ASFGVQIVGGKLAACNDPTVSSRENCTGVFWQKLFVTRLEVYGKDTEAMHPKIMVPRVWTNPRNF 1151

Human  1388 NFDNVGLGYLSLLQVATFKGWTI---IMYAAVDSVNVDKQPKYEYSLYMYIYFVVFIIFGSFFTL 1449
            |||:||...|:|.:..:||||.:   |:::             .:..:..::..:::..|....|
 Worm  1152 NFDHVGNAMLALFETLSFKGWNVIRDILWS-------------RHGPWAVVFIHIYVFIGCMIGL 1203

Human  1450 NLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGN--KIQGCIFDLV 1512
            .||:||:|.|:.|.:     ....:|.:|:::::...:|...:|....|:|..  :::..::||.
 Worm  1204 TLFVGVVIANYTQNR-----GTALLTVDQRRWHDLKARLKMAQPLHVPPKPSESARLRTKLYDLT 1263

Human  1513 TNQAFDISIMVLICLNMVTMMV-----EKEGQSQH---MTEVLYWINVVFIILFTGECVLKLISL 1569
            .::.|:.:..:|:.||..|:::     |:|.::.:   :|.:..::|::|:|    |.:||:|: 
 Worm  1264 MSRWFNQAFALLVVLNSFTLVIPWNVEEEEQRATYVFTVTALAAFMNMLFVI----EIILKVIA- 1323

Human  1570 RHYYFTVGW----NIFDFVVVIISIVGMFLADLIETYFVSPTLFRV-----IRLAR--------- 1616
              |.|:..|    |..|.::.:..::.:||     .:||:....::     :.|.:         
 Worm  1324 --YTFSGFWQSRRNRVDLLITVFGVIWIFL-----HFFVALPSSKIDVDVQVELKKFTYTFGYLV 1381

Human  1617 -IGRILRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFN 1680
             |.|...:......::.|:..::||:...|.|...|||::..||..|:..|..||....::...|
 Worm  1382 VILRFFTIASRNSTLKMLMLTVIMSMFRSFFIITALFLLVLFYAYTGVILFPMVKYGMAVSKHVN 1446

Human  1681 FETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSV-EGDCGNPSVGIFYFVSYI 1744
            |.|...:::.||:..|...|:.::...:.| .|.|   ..:.|.:. |.||||....|.||.|:.
 Worm  1447 FRTASEALVVLFRCLTGEDWNDIMHDCMRS-APFC---YWNEGMNYWETDCGNFYGAIIYFCSFY 1507

Human  1745 IISFLVVVNMYIAVILENFSV-ATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFSKLSDFAAA 1808
            :|...:|.|:.:|||:||||: .:.|....||..|...|..||...|.:..:.|...::. |...
 Worm  1508 LIITYIVRNLLVAVIMENFSLFYSSEEDALLSYADIRNFQYVWNMVDQEQKRTIPVERVK-FLLR 1571

Human  1809 LDPPLLIAKPNKVQLIAMDL-----PMVSGDRIHCLDILFAFTKRV--LGESGEMDSLRSQMEER 1866
            |....|...|.|.:::...:     .:.:|:.:...|:|:..:.|.  :.:|.:::.|..:.|..
 Worm  1572 LLKGRLEVDPEKDRILFKHMCYEMERLHNGEEVSFHDVLYMLSYRSVDIRKSLQLEELLQREELE 1636

Human  1867 FMSANPSKVSYEPITTTLK---RKQEDVSATVIQRAYRRYRLRQNVKNI---------------S 1913
            |:.  ..:|:.:.|.|.|:   ||..:.|             :::.:.:               |
 Worm  1637 FII--EEEVAKQTIRTWLEGCLRKMRNPS-------------QKDAEGVLPFGGGHPVIHSSGHS 1686

Human  1914 SIYIKDGDRDDDLLNKKDMAFDNVNENS-SPEKTDATSSTTSPP 1956
            ||     ..::.:..:  :.|:|:..:| ..|:|:::...|.||
 Worm  1687 SI-----SHEETVAQR--LRFENIRGDSVDTEETESSEEETPPP 1723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN9ANP_001352465.1 I. {ECO:0000305} 112..410 59/319 (18%)
Ion_trans 125..410 CDD:306908 59/319 (18%)
Na_trans_cytopl 488..681 CDD:314757 11/193 (6%)
II. {ECO:0000305} 726..989 57/274 (21%)
Ion_trans 743..956 CDD:306908 42/224 (19%)
Na_trans_assoc 982..1187 CDD:310839 51/273 (19%)
III. {ECO:0000305} 1180..1488 75/365 (21%)
Ion_trans 1191..1466 CDD:306908 69/332 (21%)
Na_channel_gate 1458..1510 CDD:240441 8/54 (15%)
IV. {ECO:0000305} 1497..1795 83/329 (25%)
Ion_trans 1514..1770 CDD:306908 72/285 (25%)
GPHH 1774..1837 CDD:318993 14/68 (21%)
unc-77NP_001293824.1 Ion_trans 107..383 CDD:278921 52/312 (17%)
Ion_trans 455..660 CDD:278921 49/232 (21%)
Ion_trans 973..1214 CDD:278921 54/254 (21%)
Ion_trans 1310..1534 CDD:278921 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.