DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN8A and CCH1

DIOPT Version :8

Sequence 1:NP_001317189.1 Gene:SCN8A / 6334 HGNCID:10596 Length:1980 Species:Homo sapiens
Sequence 2:NP_011733.3 Gene:CCH1 / 853131 SGDID:S000003449 Length:2039 Species:Saccharomyces cerevisiae

Alignment Length:2120 Identity:394/2121 (19%)
Similarity:711/2121 (34%) Gaps:721/2121 (34%)


Human    11 PDSFKP-----FTPESLANIERRIAESKLKKPPKADGSHREDDEDS------KPKPNSDLEAGKS 64
            ||...|     .||.|:          .|...|..:||..|..|.|      ||.|.        
Yeast   232 PDVHTPNVGASATPGSI----------HLTPEPAQNGSVSEGLEGSINNSRKKPSPK-------- 278

Human    65 LPFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATP------ALYILSPFNLIRR 123
              |.:...||      .||.|...:.:....:|:......:..:.|      :|.:.||.|.:|.
Yeast   279 --FFHHLSPQ------KEDKDQTEVIEYAEDILDFETLQRKLESRPFVLYGHSLGVFSPTNPLRI 335

Human   124 IAIKILIHSVFSMI---------IMCTILT----NCVFM-TFSNPPDWSKNVEYTFTGIYTFESL 174
            ...:.|:|..:|::         |:..|.|    |.||: .|||   |:....:..:..:|...:
Yeast   336 KIARFLLHRRYSLLYNTLLTFYAILLAIRTYNPHNVVFLYRFSN---WTDYFIFILSACFTGNDI 397

Human   175 VKIIARGFCIDG----------------------------------------------------- 186
            .||||.||..|.                                                     
Yeast   398 AKIIAFGFWDDSEMFKAYGREYKSILQRSGIMKLYIYLREKYGRKLIDFIIPFRIISPGEETKYQ 462

Human   187 ------------------------FTFLRDPWN----------WLDFSVIMMAYVTEFVDLGNVS 217
                                    ..|.|..||          ||...:.:.:|.|:       :
Yeast   463 RSSLSTSLTKPYGAKENQRPFGTPRAFARSSWNRIDLVSSVSFWLGMFLSIKSYDTK-------T 520

Human   218 ALRTFR---VLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRN 279
            .:|.|:   :||.|:.::|..|:.:|:..|...:.:|.:|..:.|:....|.::|:|:|.|:.|.
Yeast   521 GIRIFKPLAILRILRLVNVDTGMPSILRGLKYGIPQLVNVSSMLVYFWIFFGILGVQIFQGSFRR 585

Human   280 KCVVW------------PINFNESYLENGTKGFDWEEYINNKTNFYTVPGMLEPLLCGNSSDAGQ 332
            :| ||            .:.|...||:..||         .|.|:....|..     |:.|....
Yeast   586 QC-VWFNPEDPTDTYQYDMQFCGGYLDPVTK---------RKQNYIYEDGSE-----GSVSKGFL 635

Human   333 CPEGYQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFV 397
            ||:..:|: :..||..|..|||....:...:|.:|:.:.:.:|...|:.:......:||::.|||
Yeast   636 CPQYSKCV-SNANPYNGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDSDEMAACLFFIVCIFV 699

Human   398 GSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSAGTVSEDA 462
            .:.:|:||::||:..::|..|:      |.|:.:|      :...::....|.:.|...      
Yeast   700 LTIWLLNLLIAVLVSSFEIANE------EYKKKKF------IYGSRKTGYVARIVTGYW------ 746

Human   463 IEEEGEEGGGSPRSSSEISKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRK 527
                                                                            |
Yeast   747 ----------------------------------------------------------------K 747

Human   528 AFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVE 592
            .|:|..|:  .||...:|..|:|                                     :|.||
Yeast   748 YFKLKANQ--TKFPNWSQKGLAI-------------------------------------YSHVE 773

Human   593 ESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLRRSVKRNSTVDCNGVVSLIGGPGS 657
                   .:|:.:...:                     ..:|.|||.:::.:||.::.       
Yeast   774 -------FIFVILIICD---------------------IGMRASVKVSTSANCNNILL------- 803

Human   658 HIGGRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVVTNTLVEELEESQRKCPPC 722
                                               :.||..||:     ..:|.|.......|..
Yeast   804 -----------------------------------KTDRGISIV-----LFIESLARLVLYLPNM 828

Human   723 WYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAV 787
            |                                                                
Yeast   829 W---------------------------------------------------------------- 829

Human   788 GNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEG--------LSVL- 843
                           |.:....|.|         .||:|:..:.:|...|||        ||:. 
Yeast   830 ---------------KFLTKPSYVY---------DFIISIITLVISCLAVEGVLGHMYAWLSIFH 870

Human   844 --RSFRLLRVFKLAKS-WPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 905
              |.:|::..|.|.|. |.      :|:.|.| .:.||:.......|:.|:: |.:    |.|.|
Yeast   871 ISRFYRVIISFNLTKKLWK------QILSNGV-MIWNLSSFYFFFTFLVAII-MAV----YFEGV 923

Human   906 CKINQDCELPRWHMHDFFHSFLIVFRVLCGE-WIETMWDCME----VAGQAMCLIVFMMVMVIGN 965
            ....:..:.| :.|:...:|||.:|.:...| |.:.::...:    ::....|.:.|::..::.|
Yeast   924 IPPEEMADQP-FGMYSLPNSFLSLFIIGSTENWTDILYALQKHSPNISSTFFCSVFFIIWFLLSN 987

Human   966 LVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADE 1030
            .|:||:|:||:..|                                       |:...:::...:
Yeast   988 SVILNIFIALISES---------------------------------------MEVKEEEKRPQQ 1013

Human  1031 VKP-LDELYEKKANCIANHTGADI-----------HRNGD------FQKNGN---GTTSGIGSSV 1074
            :|. |..:|.:|   |..:|.|.:           |||.|      |...|.   .....:|...
Yeast  1014 IKHYLKFVYPQK---IQEYTHASLVARIRKKFFGGHRNEDTRDFKQFLMRGTAIMNIAQNMGELA 1075

Human  1075 EKYIIDEDHMSFINN-PNLTVRVPIAVGESDFEN----LNTEDVSSESDPEGSKDKLDDTSSSEG 1134
            :::........|... ..||:.||.......|.|    .|::.|.:|::....:..:.:.:..|.
Yeast  1076 DEFKEPPSENLFKKGLSKLTIGVPSLKRLRMFANNPFYKNSDVVFTETNDINGRTYILELNEYED 1140

Human  1135 STIDIKPEVEEVPVEQPEEY-LDPDACFTEGCVQRFKCCQVNIEEGLGK----------SWWILR 1188
            ..:|.   :::.|:.....| ..|...|     :||  ||..:....||          |..:..
Yeast  1141 EKLDY---LKKYPLFNYSYYFFSPQHRF-----RRF--CQRLVPPSTGKRTDGSRFFEDSTDLYN 1195

Human  1189 KTCFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTIL------EYADKVFTYIFILEM 1247
            |..:.   |:......:|:..|::..|.....|:.....:...:      ...|..|...|.:|.
Yeast  1196 KRSYF---HHIERDVFVFIFALATILLIVCSCYVTPLYRMHHKMGTWNWSSALDCAFIGAFSIEF 1257

Human  1248 LLKWTAYGFV----KFFTNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALS 1308
            ::|..|.||:    .:..|.|.::||.::....::|||.......|..|  .:.|.|||.||.|:
Yeast  1258 IVKTVADGFIYSPNAYLRNPWNFIDFCVLISMWINLIAYLKNNGNLSRI--FKGLTALRALRCLT 1320

Human  1309 RFEGMRVVVN-ALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIEDVNN 1372
            .....|...| .:...:..|....|:.|.....|::.|:::|.|:...| |:.|         ..
Yeast  1321 ISNTARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLGTC-NDGS---------LG 1375

Human  1373 KTECEKLMEGNNTEIRW--------KNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPD 1429
            :.:|..  |.:|:..:|        :...::.|:..:.:.:|.|:.:.:||:|::...::|....
Yeast  1376 RADCYN--EYSNSVFQWDIMSPRVYQQPYLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIG 1438

Human  1430 EQPKYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKK 1494
            .......:....::.|:|......|.||||:..|::|   |.:..|  ..:.|.|:|.:..:.|.
Yeast  1439 TPATVMGSAGNALFLVLFNFLSMVFILNLFVSFIVNN---QARTTG--SAYFTIEEKAWLESQKL 1498

Human  1495 LGSKKPQKPIPR--PLNKIQGIVFDFVTQQA---FDIVIMMLICLNMVTMMVETDTQSKQMENIL 1554
            |...|| |.||.  .|::::...:....::.   :...:.:::.|:::.::    ::|....|::
Yeast  1499 LSQAKP-KAIPNLIELSRVRQFFYQLAVEKKNFYYASFLQVVLYLHIIMLL----SRSYNPGNLI 1558

Human  1555 YWINLVFVIFFTCECVLKMFALR------HYYFTIGWNIFDFVVVILSIV--------------- 1598
            .:..:.|:  |:....|...||.      ..||...||.....::|::.:               
Yeast  1559 GYQGVYFM--FSTSVFLIQEALHMCGEGPRLYFRQKWNSIRLSIIIIAFIMNAVAFHVPASHYWF 1621

Human  1599 ----GMFLADIIEKYFVSP---TLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGL 1656
                |.||..|.  .|:.|   ||..::..|                      |.|||.:.::..
Yeast  1622 HNIKGFFLLVIF--LFIIPQNDTLTELLETA----------------------MASLPPILSLTY 1662

Human  1657 ---LLFLVMFIF--SIFGMSNFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILN 1716
               :||||..|.  .|||::...     :...|..||.|...|||.||:.:...||:.::..:..
Yeast  1663 TWGVLFLVYAIALNQIFGLTRLG-----SNTTDNINFRTVIKSMIVLFRCSFGEGWNYIMADLTV 1722

Human  1717 RPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFSVATEE--SADP 1779
            ..|.||.|.....:    |||:.:......:|:.|||..|.|||::::|:.|||.....  |...
Yeast  1723 SEPYCSSDDNSTYT----DCGSETYAYLLLMSWNIISMYIFVNMFVSLIIGNFSYVYRSGGSRSG 1783

Human  1780 LSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPL-------RVPKPNTIELIAMDLPMV 1837
            ::..:.:.:.|.|.|||.|.|..:|...|.....:.:.||       |:    ||:.:..:...|
Yeast  1784 INRSEIKKYIEAWSKFDTDGTGELELSYLPRIMHSFDGPLSFKIWEGRL----TIKSLVENYMEV 1844

Human  1838 SGDRIHCLDILFAFTKRVLGDSGELDILRQQME-ERFVAS 1876
            :.|..:.:.|......:.|....:..|:::::: .|||.|
Yeast  1845 NPDDPYDVKIDLIGLNKELNTIDKAKIIQRKLQYRRFVQS 1884

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN8ANP_001317189.1 I. {ECO:0000305} 114..442 92/444 (21%)
Ion_trans 131..421 CDD:306908 84/406 (21%)
Na_trans_cytopl 502..688 CDD:314757 19/186 (10%)
II. {ECO:0000305} 735..1007 47/289 (16%)
Ion_trans 752..965 CDD:306908 39/230 (17%)
Na_trans_assoc 991..1192 CDD:310839 39/238 (16%)
III. {ECO:0000305} 1180..1495 71/344 (21%)
Ion_trans 1197..1473 CDD:306908 62/295 (21%)
Na_channel_gate 1465..1517 CDD:240441 14/54 (26%)
IV. {ECO:0000305} 1504..1801 75/337 (22%)
Ion_trans 1522..1776 CDD:306908 64/292 (22%)
GPHH 1780..1843 CDD:318993 16/70 (23%)
IQ 1894..1915 CDD:197470
CCH1NP_011733.3 Ion_trans 486..722 CDD:278921 64/265 (24%)
Ion_trans 795..1010 CDD:278921 58/402 (14%)
Ion_trans 1228..1480 CDD:278921 57/269 (21%)
Ion_trans 1566..1776 CDD:278921 60/245 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I511
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.952 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R175
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.