DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN8A and scn8aa

DIOPT Version :8

Sequence 1:NP_001317189.1 Gene:SCN8A / 6334 HGNCID:10596 Length:1980 Species:Homo sapiens
Sequence 2:XP_005162325.1 Gene:scn8aa / 58152 ZFINID:ZDB-GENE-000828-1 Length:1960 Species:Danio rerio

Alignment Length:1994 Identity:1632/1995 (82%)
Similarity:1784/1995 (89%) Gaps:50/1995 (3%)


Human     1 MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSL 65
            |||.|||||||:|:|.||.|||..||:||.|.|.|.|||.|.|:|:||:::|||||.||||||||
Zfish     1 MAAPLLAPPGPNSYKYFTRESLREIEKRIEEEKAKPPPKPDNSYRDDDDENKPKPNGDLEAGKSL 65

Human    66 PFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILI 130
            ||||||||.|:||.|||||||:|:.||||||||:|||:||||||||||::|||||.|||||||||
Zfish    66 PFIYGDIPPGMVATPLEDFDPFYINQKTFVVLNKGKTIFRFSATPALYMISPFNLARRIAIKILI 130

Human   131 HSVFSMIIMCTILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWN 195
            ||||||.||||||||||||||||||:|||.|||||||||||||.|||||||||||||||||||||
Zfish   131 HSVFSMFIMCTILTNCVFMTFSNPPEWSKQVEYTFTGIYTFESAVKIIARGFCIDGFTFLRDPWN 195

Human   196 WLDFSVIMMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVF 260
            ||||.||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish   196 WLDFMVISMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVF 260

Human   261 CLSVFALIGLQLFMGNLRNKCVVWPINFNESYLE-NGTKGFDWEEYINNKTNFYTVPGMLEPLLC 324
            ||||||||||||||||||.|||:||||..|.:.: ||::.|:|:|||.|:||||.:|..|:.|||
Zfish   261 CLSVFALIGLQLFMGNLRQKCVIWPINITEMFPDVNGSRAFNWDEYILNETNFYFLPDQLDALLC 325

Human   325 GNSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGKTYMI 389
            |||||:|:|||||.||||||||||||||||:|.|||||||||||||:||||||||||||||||||
Zfish   326 GNSSDSGRCPEGYTCMKAGRNPNYGYTSFDSFGWAFLALFRLMTQDFWENLYQLTLRAAGKTYMI 390

Human   390 FFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATS 454
            ||||||||||||||||||||||||||||||||:||||:|||||||||||||||||:|||.|||||
Zfish   391 FFVLVIFVGSFYLVNLILAVVAMAYEEQNQATMEEAERKEAEFKAMLEQLKKQQEDAQANAMATS 455

Human   455 AGTVSEDAIEEEGEEGGGSPRSSSEISKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSE 519
            |||||||.:|::|:..|....||||:||||||||||||||:||.:|||  :.:||||.||..|||
Zfish   456 AGTVSEDVVEDDGDGEGNLSCSSSEMSKLSSKSAKERRNRKKKWRQKE--QDKEKGDSEKFVKSE 518

Human   520 SEDGMRRKAFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFA 584
            |:||.||: ||.||||:||:.|||||||||||||||.||.||||||||     |.:|.|||||||
Zfish   519 SDDGSRRR-FRFPDNRLGRRSSIMNQSLLSIPGSPFPSRRNSKSSIFS-----RCKDGGSENEFA 577

Human   585 DDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLRRSVKRNSTVDCNGVV 649
            |||||||||.:.||||...|    :|||||:|:.|                  ||||||||||||
Zfish   578 DDEHSTVEEYDERRDSFLSP----QRRSSYTGFYG------------------KRNSTVDCNGVV 620

Human   650 SLIGGPGSHIGGRLLPEA-----------TTEVEIKKKGPGSLLVSMDQL-ASYGRKDRINSIMS 702
            ||| |||.  |||||||.           ||::|||||..|||:||::|| .|:|||:|.||:||
Zfish   621 SLI-GPGP--GGRLLPEVIIDKAATDDSPTTDLEIKKKLSGSLMVSVEQLNTSFGRKERANSVMS 682

Human   703 VVTNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNT 767
            .:|||||||||||||||||||||||||||||||.|.|:.:|||||||||||||||||||||||||
Zfish   683 ALTNTLVEELEESQRKCPPCWYKFANTFLIWECGPLWMSIKEIVNLIVMDPFVDLAITICIVLNT 747

Human   768 LFMAMEHHPMTPQFEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMEL 832
            |||||||:||||||||||:|||||||||||||||.||:|||||||||||||||||||||||||||
Zfish   748 LFMAMEHYPMTPQFEHVLSVGNLVFTGIFTAEMFAKLVAMDPYYYFQEGWNIFDGFIVSLSLMEL 812

Human   833 SLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF 897
            .||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish   813 GLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF 877

Human   898 GKSYKECVCKINQDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMV 962
            |||||:|||||.||||||||||:||||||||||||||||||||||||||||||||||||||||||
Zfish   878 GKSYKDCVCKIAQDCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMV 942

Human   963 IGNLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQRE 1027
            |||||||||||||||||||||||||:|||||||||||:|||||||:||.|.||...:.....::.
Zfish   943 IGNLVVLNLFLALLLSSFSADNLAASDDDGEMNNLQIAVIRIKKGIAWVKAKVRELVNIILGRKV 1007

Human  1028 ADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNL 1092
            .||.||||::|::|.||||||||.||.|:.|:|||||||||||||||.||:||:||||||:||||
Zfish  1008 TDEAKPLDDMYDRKLNCIANHTGVDISRDLDYQKNGNGTTSGIGSSVGKYMIDDDHMSFIHNPNL 1072

Human  1093 TVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIKPEVEE-VPVEQPEEYLD 1156
            ||.|||||||||||||||||.||||:.||||: |||.|||||||||||||||| |.||..|||:|
Zfish  1073 TVCVPIAVGESDFENLNTEDFSSESEAEGSKE-LDDISSSEGSTIDIKPEVEEAVVVETVEEYVD 1136

Human  1157 PDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIY 1221
            |:||:||.|:.|:|||.|.|.||.||:||.|||||:||||||||||.||||||||||||||||:|
Zfish  1137 PEACWTEACIARYKCCDVPITEGWGKNWWFLRKTCYLIVEHNWFETLIIFMILLSSGALAFEDVY 1201

Human  1222 IEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVAVSLVSLIANALGY 1286
            ||||||||.||||||.||||||||||||||.||||||:||||||||||.||.||:||||||||||
Zfish  1202 IEQRKTIRIILEYADMVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFFIVDVSIVSLIANALGY 1266

Human  1287 SELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAG 1351
            |:||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||
Zfish  1267 SDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNMFAG 1331

Human  1352 KYHYCFNETSEIRFEIEDVNNKTECEKLMEGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWM 1416
            ||:||:|||.:..||::.||||:||..|:|.|.||:|||||||||||||||||||||||||||||
Zfish  1332 KYYYCYNETEKAYFELDVVNNKSECFALIEQNYTEVRWKNVKINFDNVGAGYLALLQVATFKGWM 1396

Human  1417 DIMYAAVDSRKPDEQPKYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFM 1481
            ||||||||||:.::|||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish  1397 DIMYAAVDSRRVEDQPKYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFM 1461

Human  1482 TEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQ 1546
            ||||||||||||||||||||||||||.||:||:||||||||.|||.||:||||||||||||||.|
Zfish  1462 TEEQKKYYNAMKKLGSKKPQKPIPRPQNKLQGMVFDFVTQQVFDISIMILICLNMVTMMVETDDQ 1526

Human  1547 SKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFV 1611
            |::.||||||||.:|::.||.|.|||:|||||||||.||||||.||||||||||||||:||||||
Zfish  1527 SQETENILYWINFIFIVAFTSEFVLKLFALRHYYFTNGWNIFDCVVVILSIVGMFLADLIEKYFV 1591

Human  1612 SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYV 1676
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish  1592 SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYV 1656

Human  1677 KHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSV 1741
            |.|:|||||:|||||||||||||.|||||||||||.||||.||||...||:||:..||:||||||
Zfish  1657 KRESGIDDMYNFETFGNSMICLFMITTSAGWDGLLAPILNYPPDCEPTKENPGTSVKGNCGNPSV 1721

Human  1742 GIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYC 1806
            ||||||.|||:||||||||||||||||||||||||||||.|||||:||||||||||.|:|||.:.
Zfish  1722 GIFFFVMYIIVSFLIVVNMYIAIILENFSVATEESADPLCEDDFESFYEIWEKFDPTASQFITFA 1786

Human  1807 KLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEE 1871
            ||.||||.||||||||||||||||||||||||||||||||||||||||||||||:||::||||||
Zfish  1787 KLGDFADTLEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGDLDMMRQQMEE 1851

Human  1872 RFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKK-TTSNKLENGGTHREKK 1935
            ||:|:||||||:||||||||||||.:||.|:|||:|.||.|:|||||: .:|::||||||:::||
Zfish  1852 RFIAANPSKVSFEPITTTLRRKQEHMSAGVIQRAFRAHLIRKGFICKRLLSSSRLENGGTNQDKK 1916

Human  1936 ESTPSTASLPSYDSVTKPEKEKQQRAEEGRRERAKRQKEVRESK 1979
            |.||||||||||||||||||||.:.: :.:.::.|.||:|:|||
Zfish  1917 EGTPSTASLPSYDSVTKPEKEKLEES-DSKGKKGKNQKDVKESK 1959

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN8ANP_001317189.1 I. {ECO:0000305} 114..442 290/329 (88%)
Ion_trans 131..421 CDD:306908 257/291 (88%)
Na_trans_cytopl 502..688 CDD:314757 116/197 (59%)
II. {ECO:0000305} 735..1007 256/272 (94%)
Ion_trans 752..965 CDD:306908 204/213 (96%)
Na_trans_assoc 991..1192 CDD:310839 146/202 (72%)
III. {ECO:0000305} 1180..1495 279/315 (89%)
Ion_trans 1197..1473 CDD:306908 244/276 (88%)
Na_channel_gate 1465..1517 CDD:240441 49/52 (94%)
IV. {ECO:0000305} 1504..1801 256/297 (86%)
Ion_trans 1522..1776 CDD:306908 220/254 (87%)
GPHH 1780..1843 CDD:318993 54/63 (86%)
IQ 1894..1915 CDD:197470 13/21 (62%)
scn8aaXP_005162325.1 Ion_trans 151..423 CDD:278921 239/272 (88%)
ATP-synt_B 363..>456 CDD:304375 88/93 (95%)
Na_trans_cytopl 498..604 CDD:288761 79/118 (67%)
Ion_trans 750..945 CDD:278921 186/195 (95%)
Na_trans_assoc 971..1172 CDD:284034 146/202 (72%)
Ion_trans 1195..1453 CDD:278921 227/258 (88%)
Na_channel_gate 1445..1497 CDD:240441 49/52 (94%)
Ion_trans 1519..1756 CDD:278921 206/237 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368792054
eggNOG 1 0.900 E1_KOG2301
Hieranoid 1 1.000
Homologene 1 1.000 H7927
Inparanoid 1 1.050 3239 1.000 Inparanoid score I117
OMA 1 1.010
OrthoDB 1 1.010 D13170at7742
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 1 1.000 T773205
orthoMCL 1 0.900 OOG5_126819
Panther 1 1.100 LDO PTHR10037
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 1 1.500
1414.270

Return to query results.
Submit another query.