DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN8A and para

DIOPT Version :8

Sequence 1:NP_001317189.1 Gene:SCN8A / 6334 HGNCID:10596 Length:1980 Species:Homo sapiens
Sequence 2:NP_001259619.1 Gene:para / 32619 FlyBaseID:FBgn0285944 Length:2145 Species:Drosophila melanogaster

Alignment Length:2095 Identity:956/2096 (46%)
Similarity:1288/2096 (61%) Gaps:233/2096 (11%)


Human    14 FKPFTPESLANIERRIA----ESKLKKPPKADGS--------------HREDDEDSKPKPNSDLE 60
            |:|||.|||..||:|||    :.|..:..:|:|.              :.::|||..|:|:..||
  Fly    16 FRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEVPQYGRKKKQKEIRYDDEDEDEGPQPDPTLE 80

Human    61 AGKSLPF-IYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRI 124
            .|..:|. :.|..|..|.:.||||.||||....||||:::||.:|||||:.|:::|.|||.|||:
  Fly    81 QGVPIPVRLQGSFPPELASTPLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRV 145

Human   125 AIKILIHSVFSMIIMCTILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTF 189
            ||.||:|.:||:.|:.|||.||:.|.....|. .::.|..|||||||||.||::||||.:..||:
  Fly   146 AIYILVHPLFSLFIITTILVNCILMIMPTTPT-VESTEVIFTGIYTFESAVKVMARGFILCPFTY 209

Human   190 LRDPWNWLDFSVIMMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDV 254
            |||.||||||.||.:||||..:||||::|||||||||||||::::|||||||||:|:|||.|.||
  Fly   210 LRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDV 274

Human   255 MILTVFCLSVFALIGLQLFMGNLRNKCV-VWPINFNESYL--ENGTKGFDWEEYINNKTNFYTVP 316
            :|||:|.||||||:|||::||.|..||: .:|::.:...|  ||      |:.:..|.:|:|:..
  Fly   275 IILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGSWGNLTDEN------WDYHNRNSSNWYSED 333

Human   317 GMLEPLLCGNSSDAGQCPEGYQCMKA-GRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTL 380
            ..:...||||.|.||||.:.|.|::. |.||||||||||:|.||||:.|||||||:||:||||.|
  Fly   334 EGISFPLCGNISGAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVL 398

Human   381 RAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEE-QNQATLEEAEQKEA---EFKAMLEQLKK 441
            ||||..:|:||:::||:|||||||||||:|||:|:| |.:|..|||.::||   ..:|...:..|
  Fly   399 RAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEEAIREAEEAAAAKAAK 463

Human   442 QQEEAQAAAMATSAGTVSEDAIEEEGEEGGGSPRSSSEISKLSSKSAKERRNRRKKRKQKELSEG 506
            .:|.|.|.|.|.:....:|:|...  .|...||..|. ||                   .||..|
  Fly   464 LEERANAQAQAAADAAAAEEAALH--PEMAKSPTYSC-IS-------------------YELFVG 506

Human   507 EEKG----DPEKV------FKSESEDGMRRKAFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHNS 561
            .|||    :.||:      .:|||...::|:......:: ..|...::.:.||:|||||..|..|
  Fly   507 GEKGNDDNNKEKMSIRSVEVESESVSVIQRQPAPTTAHQ-ATKVRKVSTTSLSLPGSPFNIRRGS 570

Human   562 KSS-IFSFR-GPGRFRDPGSENE---------------FADDEHSTVEESEGRRDSLFIPI---R 606
            :|| .::.| |.|||..|||:.:               :|||.::....|| ...::.:|:   .
  Fly   571 RSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAVTPMSE-ENGAIIVPVYYGN 634

Human   607 ARERRSSYSGYS------------------GYSQGSRSSRIFPSLRRSVKRNSTVDC-NGVVSLI 652
            ...|.|||:.:.                  |.|..::.|:    ||....||.:|.. ||..:.:
  Fly   635 LGSRHSSYTSHQSRISYTSHGDLLGGMAVMGVSTMTKESK----LRNRNTRNQSVGATNGGTTCL 695

Human   653 --------------------GGPGSHIGGRLLPEATTEVEIKKKGPGSLLVSMDQLASYGR---- 693
                                .|...|.....:....|:..:..|....|...::|.|  ||    
  Fly   696 DTNHKLDHRDYEIGLECTDEAGKIKHHDNPFIEPVQTQTVVDMKDVMVLNDIIEQAA--GRHSRA 758

Human   694 KDRINSIMSVVTNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLA 758
            .||..|:....|....|:....:.|......|..:.|.:|:|...|:|.:|.|:|||.||||:|.
  Fly   759 SDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFCVWDCCWVWLKFQEWVSLIVFDPFVELF 823

Human   759 ITICIVLNTLFMAMEHHPMTPQFEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGF 823
            ||:|||:||:||||:||.|..:.|.||..||..||..|..|..:||:||.|.|||||||||||..
  Fly   824 ITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATFAIEATMKLMAMSPKYYFQEGWNIFDFI 888

Human   824 IVSLSLMELSLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFI 888
            ||:|||:||.|..|:||||||||||||||||||||||||:||.|:|.::|||||||.||.||:||
  Fly   889 IVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLNLLISIMGRTMGALGNLTFVLCIIIFI 953

Human   889 FAVVGMQLFGKSYKECVCKINQDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMC 953
            |||:|||||||:|.:...:. .|.:||||:..||.|||:||||||||||||:|||||.| |...|
  Fly   954 FAVMGMQLFGKNYHDHKDRF-PDGDLPRWNFTDFMHSFMIVFRVLCGEWIESMWDCMYV-GDVSC 1016

Human   954 LIVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKV-HA 1017
            :..|:..:|||||||||||||||||:|.:.:|:|...|.:.|.:..:..||.:..:|.|..: ..
  Fly  1017 IPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTADNDTNKIAEAFNRIGRFKSWVKRNIADC 1081

Human  1018 FMQAHFK-------QREADEVKPLDELY-EKKANC---IANHTGADIHRNGDFQKNGNGTTSGIG 1071
            |.....|       |...:....:..:: |.|..|   .|.|...::....|..........||.
  Fly  1082 FKLIRNKLTNQISDQPSGERTNQISWIWSEGKGVCRCISAEHGDNELELGHDEILADGLIKKGIK 1146

Human  1072 SSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGS-KDKLDDTSSSEGS 1135
            ...:..:...|.|.|..:.::....|   .:|.:.|..|:|.::..:..|| |::.....|.:||
  Fly  1147 EQTQLEVAIGDGMEFTIHGDMKNNKP---KKSKYLNNATDDDTASINSYGSHKNRPFKDESHKGS 1208

Human  1136 T---------------------IDIKPEVEEVPVE-------QPEEYLD--PDACFTEGCVQRFK 1170
            .                     :|.:.|.||.|::       ..|:.||  |..|..:...::|.
  Fly  1209 AETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDGDIIIHAHDEDILDEYPADCCPDSYYKKFP 1273

Human  1171 CCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYA 1235
            ....:.:....:.|..||...|.::|:.:|||.:|.|||:||.|||.||:::.||..::.||.|.
  Fly  1274 ILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVITMILMSSLALALEDVHLPQRPILQDILYYM 1338

Human  1236 DKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRA 1300
            |::||.||.||||:||.|.||..:||||||||||:||.|||::.:|:.:|...:.|.|::|||||
  Fly  1339 DRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRA 1403

Human  1301 LRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRF 1365
            ||||||:||.:||||||||||.|||||.|||||||||||||:||||.||||||..| .:.:..:.
  Fly  1404 LRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKC-EDMNGTKL 1467

Human  1366 EIEDVNNKTECEKLMEGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDE 1430
            ..|.:.|:..||      :....|.|..:|||:||..||.|.||||||||:.||..|:|||:.|:
  Fly  1468 SHEIIPNRNACE------SENYTWVNSAMNFDHVGNAYLCLFQVATFKGWIQIMNDAIDSREVDK 1526

Human  1431 QPKYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQ-DIFMTEEQKKYYNAMKK 1494
            ||..|.|||||:|||.||||||||||||||||||||||:||||.||. ::||||:||||||||||
  Fly  1527 QPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYYNAMKK 1591

Human  1495 LGSKKPQKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINL 1559
            :|||||.|.||||..:.|.|||:.||.:.|||:||:.|.|||.||.::....|.....:|.::|.
  Fly  1592 MGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLFIGLNMFTMTLDRYDASDTYNAVLDYLNA 1656

Human  1560 VFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARI 1624
            :||:.|:.||:||:||||::||...||:||.|||||||:|:.|:||||||||||||.||:|:|::
  Fly  1657 IFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSDIIEKYFVSPTLLRVVRVAKV 1721

Human  1625 GRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDDMFNFE 1689
            ||:|||:|||||||||||||.|||||||||.||||||||||:|||||.|.:||.::||:|::||:
  Fly  1722 GRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKSGINDVYNFK 1786

Human  1690 TFGNSMICLFQITTSAGWDGLLLPILNR----PPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYI 1750
            |||.|||.|||::|||||||:|..|:|.    |||  .||     |:.|:||:.:|||.|.:||:
  Fly  1787 TFGQSMILLFQMSTSAGWDGVLDAIINEEACDPPD--NDK-----GYPGNCGSATVGITFLLSYL 1844

Human  1751 IISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADAL 1815
            :||||||:|||||:||||:|.|||:..:.|::||::.:||||::|||:.||:|.|.:|::|.|.|
  Fly  1845 VISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDMYYEIWQQFDPEGTQYIRYDQLSEFLDVL 1909

Human  1816 EHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSK 1880
            |.||::.|||..::|:||:|:..||.::|:|||.|.||......|  :.:.:..|...:|:.|..
  Fly  1910 EPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALTKDFFARKG--NPIEETGEIGEIAARPDT 1972

Human  1881 VSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPST---- 1941
            ..|||:::||.|::||..|.::|.|:|.|.||.            |.||:..      |.|    
  Fly  1973 EGYEPVSSTLWRQREEYCARLIQHAWRKHKARG------------EGGGSFE------PDTDHGD 2019

Human  1942 -----ASLPSYDSVT 1951
                 |..|:.|..|
  Fly  2020 GGDPDAGDPAPDEAT 2034

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN8ANP_001317189.1 I. {ECO:0000305} 114..442 189/336 (56%)
Ion_trans 131..421 CDD:306908 171/295 (58%)
Na_trans_cytopl 502..688 CDD:314757 58/255 (23%)
II. {ECO:0000305} 735..1007 168/272 (62%)
Ion_trans 752..965 CDD:306908 139/213 (65%)
Na_trans_assoc 991..1192 CDD:310839 45/244 (18%)
III. {ECO:0000305} 1180..1495 191/316 (60%)
Ion_trans 1197..1473 CDD:306908 169/276 (61%)
Na_channel_gate 1465..1517 CDD:240441 38/53 (72%)
IV. {ECO:0000305} 1504..1801 180/301 (60%)
Ion_trans 1522..1776 CDD:306908 159/258 (62%)
GPHH 1780..1843 CDD:318993 30/63 (48%)
IQ 1894..1915 CDD:197470 9/21 (43%)
paraNP_001259619.1 Ion_trans 165..436 CDD:278921 162/278 (58%)
Na_trans_cytopl 515..648 CDD:288761 36/135 (27%)
Ion_trans 835..1028 CDD:278921 126/195 (65%)
Na_trans_assoc 1054..1296 CDD:284034 46/245 (19%)
Ion_trans 1318..1571 CDD:278921 160/260 (62%)
Na_channel_gate 1561..1613 CDD:240441 37/52 (71%)
Ion_trans 1636..1871 CDD:278921 149/242 (62%)
GPHH 1880..1930 CDD:293510 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1627 1.000 Inparanoid score I80
Isobase 1 0.950 0 Normalized mean entropy S5486
OMA 1 1.010
OrthoDB 1 1.010 D37221at33208
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 1 1.000 T608898
orthoMCL 1 0.900 OOG5_126819
Panther 1 1.100 O PTHR10037
Phylome 1 0.910 0.952 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R175
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.