DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN8A and Scn8a

DIOPT Version :8

Sequence 1:NP_001317189.1 Gene:SCN8A / 6334 HGNCID:10596 Length:1980 Species:Homo sapiens
Sequence 2:NP_062139.2 Gene:Scn8a / 29710 RGDID:3638 Length:1978 Species:Rattus norvegicus

Alignment Length:1980 Identity:1954/1981 (99%)
Similarity:1969/1981 (99%) Gaps:2/1981 (0%)


Human     1 MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSL 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSL 65

Human    66 PFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILI 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    66 PFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILI 130

Human   131 HSVFSMIIMCTILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWN 195
            |||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||||
  Rat   131 HSVFSMIIMCTILTNCVFMTFSNPPEWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWN 195

Human   196 WLDFSVIMMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVF 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   196 WLDFSVIMMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVF 260

Human   261 CLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTKGFDWEEYINNKTNFYTVPGMLEPLLCG 325
            |||||||||||||||||||||||||||||||||||||:|||||||||||||||.|||||||||||
  Rat   261 CLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTRGFDWEEYINNKTNFYMVPGMLEPLLCG 325

Human   326 NSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGKTYMIF 390
            |||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   326 NSSDAGQCPEGFQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGKTYMIF 390

Human   391 FVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSA 455
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   391 FVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSA 455

Human   456 GTVSEDAIEEEGEEGGGSPRSSSEISKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSES 520
            |||||||||||||:|.||||||||:||||||||||||||||||||||||||||||||||||||||
  Rat   456 GTVSEDAIEEEGEDGVGSPRSSSELSKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSES 520

Human   521 EDGMRRKAFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFAD 585
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   521 EDGMRRKAFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFAD 585

Human   586 DEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLRRSVKRNSTVDCNGVVS 650
            |||||||||||||||||||||||||||||||||||||.|||||||||||||||||||||||||||
  Rat   586 DEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQCSRSSRIFPSLRRSVKRNSTVDCNGVVS 650

Human   651 LIGGPGSHIGGRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVVTNTLVEELEES 715
            || |||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   651 LI-GPGSHI-GRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVVTNTLVEELEES 713

Human   716 QRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQ 780
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   714 QRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQ 778

Human   781 FEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGLSVLRS 845
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   779 FEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGLSVLRS 843

Human   846 FRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINQ 910
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   844 FRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINQ 908

Human   911 DCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLVVLNLFLAL 975
            :|:||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   909 ECKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLVVLNLFLAL 973

Human   976 LLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEK 1040
            |||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||
  Rat   974 LLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKVKVHAFMQAHFKQREADEVKPLDELYEK 1038

Human  1041 KANCIANHTGADIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDF 1105
            ||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1039 KANCIANHTGVDIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDF 1103

Human  1106 ENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGCVQRFK 1170
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1104 ENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGCVQRFK 1168

Human  1171 CCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYA 1235
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1169 CCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYA 1233

Human  1236 DKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRA 1300
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1234 DKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRA 1298

Human  1301 LRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRF 1365
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1299 LRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRF 1363

Human  1366 EIEDVNNKTECEKLMEGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDE 1430
            ||:.|||||:||||||||:||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1364 EIDIVNNKTDCEKLMEGNSTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDE 1428

Human  1431 QPKYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKL 1495
            ||.||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1429 QPDYEGNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKL 1493

Human  1496 GSKKPQKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLV 1560
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1494 GSKKPQKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLV 1558

Human  1561 FVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARIG 1625
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1559 FVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARIG 1623

Human  1626 RILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDDMFNFET 1690
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1624 RILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDDMFNFET 1688

Human  1691 FGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFL 1755
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1689 FGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFL 1753

Human  1756 IVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLR 1820
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1754 IVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLR 1818

Human  1821 VPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEP 1885
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1819 VPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEP 1883

Human  1886 ITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSV 1950
            ||||||||||||||||||||||||||||||||:|..|||||||||||:|||||||||||||||||
  Rat  1884 ITTTLRRKQEEVSAVVLQRAYRGHLARRGFICRKMASNKLENGGTHRDKKESTPSTASLPSYDSV 1948

Human  1951 TKPEKEKQQRAEEGRRERAKRQKEVRESKC 1980
            |||:||||||||||||||||||||||||||
  Rat  1949 TKPDKEKQQRAEEGRRERAKRQKEVRESKC 1978

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN8ANP_001317189.1 I. {ECO:0000305} 114..442 324/328 (99%)
Ion_trans 131..421 CDD:306908 286/290 (99%)
Na_trans_cytopl 502..688 CDD:314757 183/186 (98%)
II. {ECO:0000305} 735..1007 269/272 (99%)
Ion_trans 752..965 CDD:306908 210/213 (99%)
Na_trans_assoc 991..1192 CDD:310839 199/201 (99%)
III. {ECO:0000305} 1180..1495 309/315 (98%)
Ion_trans 1197..1473 CDD:306908 270/276 (98%)
Na_channel_gate 1465..1517 CDD:240441 52/52 (100%)
IV. {ECO:0000305} 1504..1801 297/297 (100%)
Ion_trans 1522..1776 CDD:306908 254/254 (100%)
GPHH 1780..1843 CDD:318993 63/63 (100%)
IQ 1894..1915 CDD:197470 21/21 (100%)
Scn8aNP_062139.2 I. {ECO:0000305} 114..442 324/328 (99%)
Ion_trans 147..421 CDD:278921 270/274 (99%)
Na_trans_cytopl 502..611 CDD:288761 109/109 (100%)
II. {ECO:0000305} 733..1005 269/272 (99%)
Ion_trans 768..963 CDD:278921 192/195 (98%)
Na_trans_assoc 989..1190 CDD:284034 199/201 (99%)
III. {ECO:0000305} 1178..1493 309/315 (98%)
Ion_trans 1213..1471 CDD:278921 252/258 (98%)
Na_channel_gate 1463..1515 CDD:240441 52/52 (100%)
IV. {ECO:0000305} 1502..1799 297/297 (100%)
Ion_trans 1537..1774 CDD:278921 237/237 (100%)
IQ 1892..1913 CDD:197470 21/21 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368300162
eggNOG 1 0.900 E1_KOG2301
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H7927
Inparanoid 1 1.050 3908 1.000 Inparanoid score I229
OMA 1 1.010
OrthoDB 1 1.010 D13170at7742
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 1 1.000 T2466328
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10037
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1212.410

Return to query results.
Submit another query.