DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN8A and cch1

DIOPT Version :8

Sequence 1:NP_001317189.1 Gene:SCN8A / 6334 HGNCID:10596 Length:1980 Species:Homo sapiens
Sequence 2:NP_593894.1 Gene:cch1 / 2542812 PomBaseID:SPAC6F6.01 Length:1854 Species:Schizosaccharomyces pombe

Alignment Length:2110 Identity:407/2111 (19%)
Similarity:728/2111 (34%) Gaps:706/2111 (33%)


Human   105 RFSATPALYILSPFNLIRRIAIKILIHSVFSMIIMCTILTNCVFMTF--SNPPDWSKNVEYTFTG 167
            |.:.||...:  ||:.|.|   :|..|.::::.|...|:.:.|.:..  .:|.|.|:.::|....
pombe   163 RANETPGRNL--PFSPILR---QIYNHPLYNIFIFVVIVLHAVLLMIRSDDPHDKSQTIDYLIIV 222

Human   168 I---YTFESLVKIIARGFCIDG------------------FTFLRDPWNWLDFSVIMMAYVTEFV 211
            |   ||.|.|:||...||..||                  .::||..||.:||..|:..::: .:
pombe   223 IGILYTLEMLLKIYLFGFLYDGSSSFYDFINSYTKKTPRTMSYLRHSWNRVDFVAIVALWIS-VI 286

Human   212 DLGNVSALRTFRV---LRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLF 273
            ........|.|.:   ||..:.:::....:||:.:|.:|...|..|:....|...:.|::|:|.|
pombe   287 GKKQQGIFRLFSMIACLRLTRLLNITRKTETILKSLKESSTPLVQVVSFNAFFGVMIAILGVQFF 351

Human   274 MGNLRNKCVVWPINFNESYLENGT-KGFDWEEYINNKTNFYTVPGMLEPLLCGNSSDAGQCPEGY 337
            ..:|..:| ||..::.:.||..|. .|..||.            |:....|..|...:...|.|:
pombe   352 KASLNRQC-VWLGDYGDQYLPTGQFCGGHWEN------------GIKRAYLDKNGFPSNVNPRGF 403

Human   338 QCMKAG-----RNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFV 397
            .|.:..     .||.....|||.|..:...:|.:|:.:.:.::....:.|......:.|::..:.
pombe   404 ICAEKSVCRVVENPYSNTVSFDNFFNSLELIFVIMSSNGFTDIMYDIMDAEYFVSCLLFIISAYF 468

Human   398 GSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEAQAAAMATSAGTVSEDA 462
            .:.:|::|::|||.                                                   
pombe   469 LTLWLMSLVIAVVT--------------------------------------------------- 482

Human   463 IEEEGEEGGGSPRSSSEISKLSSKSAKERRNRRKKRKQKELSEGEEKGDPEKVFKSESEDGMRRK 527
                                                                             
pombe   483 ----------------------------------------------------------------- 482

Human   528 AFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRFRDPGSENEFADDEHSTVE 592
                                                                 :.|.|.:||...
pombe   483 -----------------------------------------------------SSFIDLQHSGKN 494

Human   593 ESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLRRSVKRNSTVDCNGVVSLIGGPGS 657
            :.|                                      ::||.::                 
pombe   495 QKE--------------------------------------QKSVDKH----------------- 504

Human   658 HIGGRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVVTNTLVEELEESQRKCPPC 722
                                                         ::.|.|.|:           
pombe   505 ---------------------------------------------LIRNKLCEK----------- 513

Human   723 WYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAV 787
             |.|.:.|:       ||.       .::..||    |:|               |..::...:.
pombe   514 -YLFYSNFI-------WIS-------FIVAQFV----TLC---------------TQTYDQTSST 544

Human   788 GN--LVFTG----IFTAEMFLKLIAMDPYY--YFQEGWNIFDGFIVSLSLMELSLADVEGLSV-- 842
            .|  |:|..    :..||:.|:..|..|.|  :|:...|:.|..:..|:|:.| |..:....|  
pombe   545 ANRYLIFYACVDFLLAAEVILRFFAYLPDYRLFFRRYTNLVDIVLAVLNLVTL-LPSIRKNPVAF 608

Human   843 --LRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECV 905
              |..|.:.|:::.....|....:.|::.::...|.||.|.|.|::||.::..::||        
pombe   609 GWLSIFAIARIYRCILLIPYTRKIAKLLFSNFKQLLNLMLFLVIVLFIASLCAVRLF-------- 665

Human   906 CKINQDCELPRWHMHD--------FFHSFLIVFRVLCGE-WIETMWDCMEVAGQAMCL------- 954
                ||  ||.....|        .:.|||.::::|..| |.:.|:     |.||...       
pombe   666 ----QD--LPNDGDSDDDAISFATTYESFLYMYQILTSENWTDVMF-----AIQARLAHLHLSWI 719

Human   955 --IVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHA 1017
              ..|.:..:..|.|||::|:|::..:|     |.::.|.:|..|::.:.|:.:..         
pombe   720 PGAFFTLWFLFSNNVVLSMFIAVIQVNF-----APSESDLKMEQLKMYLARLLRNY--------- 770

Human  1018 FMQAHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGN--GTTSGIGSSVEKYIID 1080
                                         |...|.:..|...::||:  |.|           :|
pombe   771 -----------------------------NPFQASLTLNALIKRNGSRKGKT-----------VD 795

Human  1081 EDHMSFINNPNLTVRVPIAVGESDFENLNTED---VSSESDPEGSKDKL-------------DDT 1129
            |.|..::...|      |..|.....|:..::   .|.::.||.||..|             ||.
pombe   796 ESHYEWLYEDN------IIKGFLRVTNIPPKEPLKPSLDTSPELSKYSLAKLSNNFKRFVMRDDP 854

Human  1130 SSS-----------------EGSTIDIKPEVEEVPVEQPE------EYLD------PDACFTEGC 1165
            .|.                 :.:..|::.....|.::|.|      :|.|      |     ...
pombe   855 FSQAYFKRVIGIRWEKDMNLKTAAKDMQAAKAFVRIKQTEFLKNHPKYNDVFWVIKP-----SNR 914

Human  1166 VQRFKCCQVNIEEGLGKSW-------WILRKTCFLIVEHNWFETFIIFMILLSSGALAFEDIY-- 1221
            ::||  ||..:..|:.:.:       |:.|.          .:.||...||.   |:..|.|.  
pombe   915 IRRF--CQRLVMPGVNERYGGVEPYQWVYRV----------IQVFIYACILT---AVIIECIATP 964

Human  1222 IEQRKTIRTILEYA-----DKVFTYIFILEMLLKWTAYGFV----KFFTNAWCWLDFLIVAVSLV 1277
            |.:|..:....::|     :..|..||.:|..:|..|.||.    .:..:.|..:||.::....:
pombe   965 IYERDHLLNDKQHAWFVWTEVAFATIFTIEAAIKIIADGFCITPNAYLRSTWNCIDFFVLVTLWI 1029

Human  1278 SLIANALGYSELGAIKSLRTLRALRPLRALSRFE-GMRVVVNALVGAIPSIMNVLLVCLIFWLIF 1341
            :|.|....::.|.  ::.|..:|||.||.::..: ..|:..:||:.....|.:..:|.....:.|
pombe  1030 NLYAVLTSHALLS--RAFRAFKALRVLRLINLTQTSQRMFHDALISGFFKIFSAAVVSATLLIPF 1092

Human  1342 SIMGVNLFAGKYHYCFNETSEIRFEIEDVNNKTEC--EKLMEGNNTEI----RWKN-VKINFDNV 1399
            ::...|:|.|..:.| |:        ::|.:.::|  |.....||.|:    .|.| ...:||..
pombe  1093 ALWAKNVFGGLLYSC-ND--------DNVLSASQCVLEYASTPNNWEVWAPRVWSNPPDYDFDRF 1148

Human  1400 GAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPKYEDNIYMYIYFVIFIIFGSFFTLNLFIGVII 1464
            ....|||.::|:.:||:|||.:.:|....:.||:...:....::||:|.:....:.|.|||.:||
pombe  1149 PHALLALFEIASIEGWVDIMRSVMDITGFNNQPQTNASSGNAMFFVLFNLVSMIYILTLFIAIII 1213

Human  1465 DNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQK-PIPRPLNKIQGIVFDFVTQ------Q 1522
            .|:.::.     ...|.|.||:.:....:|:.|.:|.| |..|||. ::|:.:||..|      :
pombe  1214 SNYAERT-----GSAFFTAEQRAWLELRRKIKSMRPSKRPAIRPLG-LRGLCYDFAVQKHGIWRR 1272

Human  1523 AF-DIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIG-W 1585
            .| .:.|:.|:.|  :|:..........:.|.::   |:..|.:|....:|::.|..|||... |
pombe  1273 TFTGLYIVHLLFL--LTIFYPCPIAYTYVRNSIF---LILSICYTINICVKVYGLSFYYFFHSFW 1332

Human  1586 NIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPA 1650
            |:|| |||.|..:...:|.:.:....|.||.:...|..:  .:.||........|...::.|||:
pombe  1333 NMFD-VVVTLGSLTCNIAILAKFENRSLTLLQTTLLVLV--TVHLIPKFDNFDQLSKTVVASLPS 1394

Human  1651 LFNIGLLLFLVMFIF------SIFGMSNFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDG 1709
            :|:: :..::|::|.      .|||::....   ..|.:.  ||.:..|:::.||.:|...||:.
pombe  1395 IFSL-IATWIVLYITFAIAFNQIFGLTKLGL---NGGPNK--NFRSIRNALVLLFTMTFGEGWND 1453

Human  1710 LLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFS-VAT 1773
            ::.......|:|....:.    :..||||.......|:::.|||..|.|||:|.::.:||| :.|
pombe  1454 VMHDYTISYPNCVNGDDF----YNSDCGNKPWAYGLFIAWNIISMYIFVNMFITVVFDNFSYIHT 1514

Human  1774 EESA-DPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADAL-----------EHPLR------ 1820
            :.|: ..|..:||..|.:.|..|||..|.:|.......|..:|           ||.||      
pombe  1515 KSSSFTNLQRNDFRQFKDSWAPFDPMVTGYIPKRNAVKFVLSLRGVYDFRIYRDEHTLRSIISKV 1579

Human  1821 --------VP------------------------------KPNTIELIAMDLPMVSGDRIHCLDI 1847
                    ||                              :.|.:..:..::..:.|:.|...:|
pombe  1580 QSKTGQQSVPMLENPLMGSEINLEALDQIIDTIDVNVVKERRNVLNSLCTEIMTLPGNVISFSNI 1644

Human  1848 LFAFTKRVLGDSGELDILRQQMEERFVASNPSK-VSYEP----ITTTLRRKQ------------- 1894
            |.......:.|..|...:...:...:|.|...| :..|.    :.|::.||.             
pombe  1645 LMLVVLHKIVDHREAFPISDYIRRAYVLSELEKSIRMEKLLGLVETSIIRKTFLQHMEEKKKALE 1709

Human  1895 ------EEVSAVV----LQRAYRGHLARRGFICKKTTSNKLENGGTHREKKEST-PSTASLPSYD 1948
                  .|||.::    :|...|.|.|....:...|.:..:.:...  ...||| |:.||....|
pombe  1710 NPFILLSEVSEILPETPIQEVLRQHNADPEQLLMSTRTPSVSDRSF--SIVESTVPTIASGEGDD 1772

Human  1949 SVTKPEKEKQQRAEEGRRERAKRQKEVRES 1978
            :.:..:..|.....|.||..:.::..:|.|
pombe  1773 NHSVEDHLKVPTDNEPRRSPSLKEVLLRGS 1802

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN8ANP_001317189.1 I. {ECO:0000305} 114..442 77/360 (21%)
Ion_trans 131..421 CDD:306908 72/322 (22%)
Na_trans_cytopl 502..688 CDD:314757 7/186 (4%)
II. {ECO:0000305} 735..1007 67/302 (22%)
Ion_trans 752..965 CDD:306908 53/243 (22%)
Na_trans_assoc 991..1192 CDD:310839 41/255 (16%)
III. {ECO:0000305} 1180..1495 80/341 (23%)
Ion_trans 1197..1473 CDD:306908 73/295 (25%)
Na_channel_gate 1465..1517 CDD:240441 14/53 (26%)
IV. {ECO:0000305} 1504..1801 84/313 (27%)
Ion_trans 1522..1776 CDD:306908 67/263 (25%)
GPHH 1780..1843 CDD:318993 21/118 (18%)
IQ 1894..1915 CDD:197470 7/44 (16%)
cch1NP_593894.1 Ion_trans 201..485 CDD:278921 68/467 (15%)
Ion_trans 533..748 CDD:278921 57/255 (22%)
Ion_trans 968..1220 CDD:278921 65/263 (25%)
Ion_trans 1289..1517 CDD:278921 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.966 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R175
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.