DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN8A and unc-2

DIOPT Version :8

Sequence 1:NP_001317189.1 Gene:SCN8A / 6334 HGNCID:10596 Length:1980 Species:Homo sapiens
Sequence 2:NP_001355464.1 Gene:unc-2 / 180570 WormBaseID:WBGene00006742 Length:2171 Species:Caenorhabditis elegans

Alignment Length:2081 Identity:489/2082 (23%)
Similarity:813/2082 (39%) Gaps:599/2082 (29%)


Human    33 KLKKPPKADGSHREDD-------EDSKPKPNSD-----LEAGKSLPFIYGDIPQGLVA------- 78
            |..:|||:..|.|:|:       ||:.|:|:.|     :||.:....:.....:.|.|       
 Worm    70 KPSEPPKSKRSSRDDNSNGYAGYEDATPRPSIDFPTAVIEAARRASVLGRSAAESLSAQEAASSS 134

Human    79 ---------VPLEDFDPYYLTQKTF------------------VVLNRGKTLFRFSATP------ 110
                     .|...:......::.|                  :::.|.|...|...:|      
 Worm   135 ERGEHTNSRSPSTSYSSCIDDERKFSSPHRRRVVDVSDHKTCALLMTRMKEASRQLPSPSQLAAE 199

Human   111 -------------------------------ALYILSPFNLIRRIAIKILIHSVFSMIIMCTILT 144
                                           :|:|.:..|:|||.|..|:....|...|:.||:.
 Worm   200 EARREQKAESGTFVRKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIG 264

Human   145 NCVFMTFSNP---------PDWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFS 200
            |||.::....         .:|.:..|..|.||:..|.::|:||.||.:...::||..||.:||.
 Worm   265 NCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFI 329

Human   201 VIMMAYVT------------EFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSD 253
            |::...||            :.||..::..||..||||.||.:|.||.|:.::.:::.::..|..
 Worm   330 VVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQ 394

Human   254 VMILTVFCLSVFALIGLQLFMGNLRNKCVVWPINFNESYLENGTKGFDWEEYINNKTNFYTVPGM 318
            :.:|.:|.:.:||:|||:.:.|...:.|          |.|.|.        |.|.:.       
 Worm   395 IGLLVLFAIIIFAIIGLEFYSGAFHSAC----------YNERGE--------IENVSE------- 434

Human   319 LEPLLCGN-SSDAG--QCP-EGYQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLT 379
             .|:.|.| :|..|  .|. :|..|::....||||.||||...:|.:.:|:.:|.:.|..:...|
 Worm   435 -RPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYT 498

Human   380 LRAAGKTY-MIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQAT--------LEEAEQKEAEFKAM 435
            ..:.|.|| ..:|:.:|.:|||:::||:|.|::..:.::.:..        |...:|.|.|....
 Worm   499 NDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGY 563

Human   436 LEQLKKQQEEAQAAAMATSAGTVSEDAIEEEGEEGGGSPRSSSEISKLSSKSA-KERRNRRKKRK 499
            ||.:...:|.           .:.||...||                  .|:| .|.|.|...:|
 Worm   564 LEWILTAEEV-----------ILKEDRTTEE------------------EKAAIMEARRRAANKK 599

Human   500 QKELSEGEEKGDPEKVFKSESEDGMRRKAFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHNSKSS 564
            .|:.|: ::..:.|:.|: |.||.|                                        
 Worm   600 LKQASK-QQSTETEEDFE-EDEDEM---------------------------------------- 622

Human   565 IFSFRGPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSRI 629
                           |.|:. ||..|||:....|.                              
 Worm   623 ---------------EEEYV-DEGGTVEDEFAERK------------------------------ 641

Human   630 FPSLRRSVKRNSTVDCNGVVSLIGGPGSHIGGRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRK 694
                    ||..   |:.|            |:.:.:...::.|..|                  
 Worm   642 --------KRGC---CHSV------------GKFIKQLRIQIRIMVK------------------ 665

Human   695 DRINSIMSVVTNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAI 759
                                            ...|       ||                  ::
 Worm   666 --------------------------------TQIF-------YW------------------SV 673

Human   760 TICIVLNTLFMAMEHHPMTPQFEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFI 824
            ...:.|||..:|.||:.....|...|.....||.|||..||.|||.||....||...:|.||..:
 Worm   674 ITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVV 738

Human   825 VSLSLMELSLADVE----GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAII 885
            :..|..|:..|:|.    |:||:|:.||||:|||...|.:|..|::.:.||:.::.:|..:|.:.
 Worm   739 IVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLF 803

Human   886 VFIFAVVGMQLFGKSYKECVCKINQDCELPRWHMHDFFHSF----LIVFRVLCGE-WIETMWDCM 945
            :.|||::||||||..:           ..|..|.:..|.:|    :.||::|.|| |.|.|:..:
 Worm   804 ILIFALLGMQLFGGRF-----------NFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAI 857

Human   946 EVAGQAMC-----LIVFMMVMVIGNLVVLNLFLALLLSSFSADNL-------AATDDDGEMNNLQ 998
            |..|....     .|.|:::::.||..:||:|||:     :.|||       ||.:.|.:.|.::
 Worm   858 ESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAI-----AVDNLANAQELTAAEEADEKANEIE 917

Human   999 ISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNG 1063
                                          :|.:.|||.|::..:|..:.               
 Worm   918 ------------------------------EESEELDEQYQEGDHCTIDM--------------- 937

Human  1064 NGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDD 1128
            .|.|:|...:|.:.:.|.|                            |:...|..|.|....:..
 Worm   938 EGKTAGDMCAVARAMDDLD----------------------------EECEEEESPFGGPKPMVP 974

Human  1129 TSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFL 1193
            .||.                    .:|.|...|                          |.....
 Worm   975 YSSM--------------------FFLSPTNPF--------------------------RVLIHS 993

Human  1194 IVEHNWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFV- 1257
            ||...:||..::.:|.|||.:||.|| .:::......:|:|.|..||.:|..|||||....|.: 
 Worm   994 IVCTKYFEMMVMTVICLSSVSLAAED-PVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILL 1057

Human  1258 ---KFFTNAWCWLDFLIVAVSLVSLIANALGYS--------ELGAIKSLRTLRALRPLRALSRFE 1311
               .:..:.|..||.::|..:|.     |.|::        .|..|||||.||.||||:.:.|..
 Worm  1058 HPGSYCRDFWNILDGIVVTCALF-----AFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIP 1117

Human  1312 GMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKYHYC------FNETSEIRFEIEDV 1370
            .::.|.:.:|.::.::.|:|:|..:|..||:::.|.||.||:.:|      |..|...:|.:.|.
 Worm  1118 KLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDN 1182

Human  1371 NNKTECEKLMEGNNTEIRWKNVKINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPKYE 1435
            .|.....:..|       |:....|:||.....|.|..|.|.:||..|...::|:...|:.|...
 Worm  1183 QNDPPRVEQRE-------WRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPF 1240

Human  1436 DNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKP 1500
            ..:.:.:::|:|.|...||.:|:|:.:||..|.:|    |..::...:..|.....:....:.:|
 Worm  1241 FRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQ----GEAELSEGDLDKNQKQCIDFALNARP 1301

Human  1501 QKP-IPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIF 1564
            :.. :|...|..:..::..||...|:..||.:||.|.:.:|::........|.||...|......
 Worm  1302 RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAV 1366

Human  1565 FTCECVLKM--FALRHYYFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARIGRI 1627
            ||.|.:||:  |.:|: ||..|||.||||.|:.||....:.: ...:|||   ...:||.|..|:
 Worm  1367 FTVESILKILAFGVRN-YFRDGWNRFDFVTVVGSITDALVTE-FGGHFVS---LGFLRLFRAARL 1426

Human  1628 LRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAG--IDDMFNFET 1690
            :||::....||.||:..:.|..||..:.||:.::.||::|.||..|..:...|.  |:...||::
 Worm  1427 IRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQS 1491

Human  1691 FGNSMICLFQITTSAGWDGLLLPILNRPPDCSLDKEHPGSG----FKGD-CGNPSVGIFFFVSYI 1750
            |.|::|.||:..|..||..:::..: :..||:    ..||.    .||. ||: :|...:|.|::
 Worm  1492 FFNAVILLFRCATGEGWQDIMMAAV-QGKDCA----RAGSAEINFEKGQTCGS-NVSYAYFTSFV 1550

Human  1751 IISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADAL 1815
            .:|..:::|:::|:|::||...|.:|: .|.....:.|..:|..:||.||..|.|.::.:....:
 Worm  1551 FLSSFLMLNLFVAVIMDNFDYLTRDSS-ILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIM 1614

Human  1816 EHPLRVPK--PNTI---ELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVA 1875
            ..|:...|  |..:   .||.|::|:.....:|....|||..:.      .|.|..:.:||...|
 Worm  1615 APPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRE------SLSIKMRPVEEMDEA 1673

Human  1876 SNPSKVSYEPITTTLRRKQEEVSAVV------------LQRAYRGHLARRGFICKKTTSNKLENG 1928
            ....:::.:.| ..|:.|:..|..||            :.:.|.|.|....:..:|:.:   |.|
 Worm  1674 DEELRLTLKKI-WPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGT---EVG 1734

Human  1929 G 1929
            |
 Worm  1735 G 1735

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN8ANP_001317189.1 I. {ECO:0000305} 114..442 102/362 (28%)
Ion_trans 131..421 CDD:306908 89/316 (28%)
Na_trans_cytopl 502..688 CDD:314757 22/186 (12%)
II. {ECO:0000305} 735..1007 88/293 (30%)
Ion_trans 752..965 CDD:306908 73/227 (32%)
Na_trans_assoc 991..1192 CDD:310839 24/201 (12%)
III. {ECO:0000305} 1180..1495 92/333 (28%)
Ion_trans 1197..1473 CDD:306908 87/294 (30%)
Na_channel_gate 1465..1517 CDD:240441 7/53 (13%)
IV. {ECO:0000305} 1504..1801 96/306 (31%)
Ion_trans 1522..1776 CDD:306908 84/263 (32%)
GPHH 1780..1843 CDD:318993 16/68 (24%)
IQ 1894..1915 CDD:197470 6/33 (18%)
unc-2NP_001355464.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D172471at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R175
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.