DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN8A and scn2a

DIOPT Version :8

Sequence 1:NP_001317189.1 Gene:SCN8A / 6334 HGNCID:10596 Length:1980 Species:Homo sapiens
Sequence 2:XP_017953100.1 Gene:scn2a / 100486750 XenbaseID:XB-GENE-6447552 Length:1970 Species:Xenopus tropicalis

Alignment Length:2013 Identity:1423/2014 (71%)
Similarity:1625/2014 (81%) Gaps:92/2014 (5%)


Human     6 LAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSLPFIYG 70
            :.|||||||:.||.|||..||:||:|.|.....:    .:::.|::.||||.|||||:|||||||
 Frog     6 IVPPGPDSFRYFTRESLKAIEKRISEEKENNAKQ----EQKEGEENGPKPNRDLEAGQSLPFIYG 66

Human    71 DIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSVFS 135
            |||..:|:.||||.||||..||||:|||:||||||||||.|||||:|||.:|:.|||||:||:|:
 Frog    67 DIPPRMVSEPLEDLDPYYANQKTFIVLNKGKTLFRFSATSALYILTPFNPVRQAAIKILVHSLFN 131

Human   136 MIIMCTILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFS 200
            |:|||||||||||||.||||:|:||||||||||||.|||:||:|||||::.||||||||||||||
 Frog   132 MLIMCTILTNCVFMTLSNPPEWTKNVEYTFTGIYTLESLIKILARGFCLEKFTFLRDPWNWLDFS 196

Human   201 VIMMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVF 265
            ||::|||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   197 VIVLAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVF 261

Human   266 ALIGLQLFMGNLRNKCVVWPIN----------FNESYLENGTKGFDWEEYINNKTNFYTVPGMLE 320
            ||||||||||:|||||::||.|          ||||.                   ||.:....:
 Frog   262 ALIGLQLFMGHLRNKCLLWPYNSSVDISLYEHFNESL-------------------FYKLENQKD 307

Human   321 PLLCGNSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGK 385
            ||:||||||.|:|||||.|:||||||||||||||||:||||:||||||||.||||||||||||||
 Frog   308 PLVCGNSSDTGKCPEGYVCVKAGRNPNYGYTSFDTFNWAFLSLFRLMTQDCWENLYQLTLRAAGK 372

Human   386 TYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEAQ--A 448
            |||||||||||:||||||||||||||||||||||||:|||.||||||    ::|||||||||  |
 Frog   373 TYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATIEEAVQKEAEF----QRLKKQQEEAQALA 433

Human   449 AAMATSAGTVSEDAIEEEGEEGGGSPRSSSEISKLSSKSAKERRNRRKKRKQKELSEGEEKGDPE 513
            ||:|...|. |::..||.|.|  .:...||.:|||||||||||||.||:|||....:|:||||.|
 Frog   434 AAVADVFGE-SQELSEEVGLE--DASECSSTVSKLSSKSAKERRNWRKQRKQVAHCDGQEKGDKE 495

Human   514 KVFKSESEDGMRRKA--FRLPDNRIG--RKFSIMNQSLLSIPGSPFLSRHNSKSSIFSFRGPGRF 574
            |.:||.|||.::||.  |.....|:.  ||.|:.:||||||.|..|..|.|||:|||||:  .|.
 Frog   496 KCYKSGSEDSIKRKGLNFTREGRRLEEYRKSSMPHQSLLSIQGPVFSPRRNSKTSIFSFK--DRA 558

Human   575 RDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLRRSVKR 639
            :|.||||:|||||.||.|| :.|||.||:|.|.|.||:     |..||.||||||.|.|..:.|.
 Frog   559 KDVGSENDFADDERSTFEE-DSRRDPLFVPGRHRARRN-----SNISQTSRSSRILPLLSMNGKM 617

Human   640 NSTVDCNGVVSLIGGPGSHIGGRLLPEATTEVEIKKKGPGSLLVSMDQLASYGRKDRINSIMSVV 704
            :|||||||||||:||..:.||  |.||.||....:|:.|.|..:|||.:.....:.|..||.|::
 Frog   618 HSTVDCNGVVSLVGGSSAPIG--LFPEGTTTETDRKRRPSSYKISMDLMEDPSLRQRAQSIASIL 680

Human   705 TNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIVMDPFVDLAITICIVLNTLF 769
            |||: |||:||:||||.|||||||.||||:|...|:|:|.||.||||||||||||||.|||||:|
 Frog   681 TNTM-EELQESRRKCPSCWYKFANCFLIWDCCEAWLKVKRIVKLIVMDPFVDLAITISIVLNTIF 744

Human   770 MAMEHHPMTPQFEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSL 834
            ||:||..|||.|..||..||.||||||||||.|||||:|||||||||||||||.|||||||||.|
 Frog   745 MAVEHAHMTPYFISVLTTGNQVFTGIFTAEMVLKLIALDPYYYFQEGWNIFDGLIVSLSLMELGL 809

Human   835 ADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGK 899
            :...|.||||||||||||||||||||||.||||||||||||||||||||||||||||||||||||
 Frog   810 SSTGGFSVLRSFRLLRVFKLAKSWPTLNKLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGK 874

Human   900 SYKECVCKINQDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIG 964
            |||||||||.::||||||||:||||||||||||||||||||||||||||||:|||:|||:|||||
 Frog   875 SYKECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLLVFMLVMVIG 939

Human   965 NLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVHAFMQAHF--KQRE 1027
            |||||||||||||||||:|||:|||:|.|:||:||:|.||::|||..|:.:..|.:..|  ||::
 Frog   940 NLVVLNLFLALLLSSFSSDNLSATDEDSEINNIQIAVGRIQRGVASGKIILREFFEKLFLQKQKD 1004

Human  1028 ADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTTSGIGSSVEKYIIDE-DHMSFINNPN 1091
            .:|.|.|:|...|...|:..:...:|.:..:..::.:|.||.|||||||...:| ::|:.||..:
 Frog  1005 INETKQLEETPGKNDTCVLGNAVVEILKEKNDVRDSDGMTSEIGSSVEKSAENEKEYMTVINKTS 1069

Human  1092 LTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIK----PEVEEVPVEQPE 1152
            |||.||||.|||||||.|||:.|||||||.:|:|:..:||||||||||:    ..:||....:.|
 Frog  1070 LTVAVPIAPGESDFENPNTEEFSSESDPEETKEKIKVSSSSEGSTIDIRAPGVERIEEFLDYEYE 1134

Human  1153 EYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGALAF 1217
            |..||:.|||:.||..|.|||:|||.|.|:.||.|||||:.||||:|||:|||||||||||||||
 Frog  1135 ETFDPEPCFTDDCVASFTCCQINIENGTGRDWWNLRKTCYTIVEHSWFESFIIFMILLSSGALAF 1199

Human  1218 EDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTNAWCWLDFLIVAVSLVSLIAN 1282
            ||||:|||:.::.|||||||||.||||:||||||.||||:|:||||||||||:||.:||||||||
 Frog  1200 EDIYVEQRRNVKAILEYADKVFAYIFIMEMLLKWVAYGFIKYFTNAWCWLDFIIVDISLVSLIAN 1264

Human  1283 ALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVN 1347
            ||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||
 Frog  1265 ALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLIFWLIFSIMGVN 1329

Human  1348 LFAGKYHYCFNETSEIRFEIEDVNNKTECEKLMEGNNT-EIRWKNVKINFDNVGAGYLALLQVAT 1411
            |||||::||.|.||.:.|...||||.::|.  |..|.| ..||||||:|||||||||||||||||
 Frog  1330 LFAGKFYYCVNTTSGVPFPATDVNNYSDCR--MYINTTGAARWKNVKVNFDNVGAGYLALLQVAT 1392

Human  1412 FKGWMDIMYAAVDSRKPDEQPKYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGG 1476
            |||||.|||||||||:.:||||||:|..||:|||.|||||||||||||||||||||||||||..|
 Frog  1393 FKGWMPIMYAAVDSREINEQPKYENNTTMYLYFVAFIIFGSFFTLNLFIGVIIDNFNQQKKKIRG 1457

Human  1477 QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFDFVTQQAFDIVIMMLICLNMVTMMV 1541
            |||||||||||||||||||||||||||||||.|..||::|||||:|||||:||:||.|||||||:
 Frog  1458 QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANCCQGLIFDFVTKQAFDIIIMILIFLNMVTMMI 1522

Human  1542 ETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNIFDFVVVILSIVGMFLADII 1606
            |||.||::||..||.||.||:|.||.|.:||:.:||.|||||||||||.||||||||||||||||
 Frog  1523 ETDDQSQEMEMYLYRINAVFIILFTGEFLLKLISLRQYYFTIGWNIFDLVVVILSIVGMFLADII 1587

Human  1607 EKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMS 1671
            |:||.|||||||||||||||||||||.|||||||||||||||||||||||||||||||::|||||
 Frog  1588 ERYFFSPTLFRVIRLARIGRILRLIKAAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS 1652

Human  1672 NFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNR-PPDCSLDKEHPGSGFKGD 1735
            ||||||.::||||||||||||||||||||||||||||.||.||||. .|||..:.|||||.||||
 Frog  1653 NFAYVKKQSGIDDMFNFETFGNSMICLFQITTSAGWDLLLEPILNSGEPDCDPNAEHPGSLFKGD 1717

Human  1736 CGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDAT 1800
            ||||||||||||||||||||||||||||:|||||||||||||:||.|||||.|||:||||||.|:
 Frog  1718 CGNPSVGIFFFVSYIIISFLIVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEVWEKFDPSAS 1782

Human  1801 QFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDIL 1865
            |||||.||:||||||:.||||||||.|:|||||||||||||||||||||||||||||:.||:|.|
 Frog  1783 QFIEYSKLSDFADALDPPLRVPKPNNIQLIAMDLPMVSGDRIHCLDILFAFTKRVLGEGGEMDSL 1847

Human  1866 RQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGT 1930
            ||.|||||:.||||||.||||||||||||||.||||:||.|      |.|..||..:::...|..
 Frog  1848 RQPMEERFMTSNPSKVPYEPITTTLRRKQEEQSAVVIQRCY------RRFRLKKRQASQTYKGNR 1906

Human  1931 HREKKE------------------STPSTASLPSYDSVTKPEKEKQQRAEEGRRERAKRQKEV 1975
            :::.:|                  ::.||.|.||||||.|.::||.::..:.::...|.|.:|
 Frog  1907 NKQIEEIERNVNKSQQRYTTEISDTSTSTMSPPSYDSVEKTQQEKYEKDRQKKKISLKTQNDV 1969

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN8ANP_001317189.1 I. {ECO:0000305} 114..442 259/338 (77%)
Ion_trans 131..421 CDD:306908 235/300 (78%)
Na_trans_cytopl 502..688 CDD:314757 99/190 (52%)
II. {ECO:0000305} 735..1007 227/272 (83%)
Ion_trans 752..965 CDD:306908 185/213 (87%)
Na_trans_assoc 991..1192 CDD:310839 101/208 (49%)
III. {ECO:0000305} 1180..1495 259/316 (82%)
Ion_trans 1197..1473 CDD:306908 228/277 (82%)
Na_channel_gate 1465..1517 CDD:240441 45/52 (87%)
IV. {ECO:0000305} 1504..1801 246/298 (83%)
Ion_trans 1522..1776 CDD:306908 215/255 (84%)
GPHH 1780..1843 CDD:318993 52/63 (83%)
IQ 1894..1915 CDD:197470 11/21 (52%)
scn2aXP_017953100.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D37221at33208
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.