DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN8A and scn3a

DIOPT Version :8

Sequence 1:NP_001317189.1 Gene:SCN8A / 6334 HGNCID:10596 Length:1980 Species:Homo sapiens
Sequence 2:XP_012826714.1 Gene:scn3a / 100125099 XenbaseID:XB-GENE-5812330 Length:2019 Species:Xenopus tropicalis

Alignment Length:2036 Identity:1507/2037 (74%)
Similarity:1691/2037 (83%) Gaps:75/2037 (4%)


Human     1 MAARLLAPPGPDSFKPFTPESLANIERRIAESKLKKPPKADGSHREDDEDSKPKPNSDLEAGKSL 65
            |...||.||||||.:..|.||||.:|:|.||.|.:|..:.|  .|:||:::.|||||||||||:|
 Frog     1 MEQPLLPPPGPDSLRLLTRESLAVLEKRFAEEKARKASQKD--RRDDDDENGPKPNSDLEAGKNL 63

Human    66 PFIYGDIPQGLVAVPLEDFDPYYLTQKTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILI 130
            ||||||||||:||||:||.||||..||||:||||||.:||||||.|||||:|||.:|||:||||:
 Frog    64 PFIYGDIPQGMVAVPMEDLDPYYSNQKTFIVLNRGKAIFRFSATSALYILTPFNPLRRISIKILV 128

Human   131 HSVFSMIIMCTILTNCVFMTFSNPPDWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWN 195
            ||:|||:|||||||||.|||.||||:|:|||||||||||||||||||:|||||::.|||||||||
 Frog   129 HSLFSMLIMCTILTNCFFMTMSNPPEWTKNVEYTFTGIYTFESLVKILARGFCLESFTFLRDPWN 193

Human   196 WLDFSVIMMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVF 260
            |||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   194 WLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVF 258

Human   261 CLSVFALIGLQLFMGNLRNKCVVWPIN--------FNES---YLENGTKGFDWEEYINNKTNFYT 314
            |||||||||||||||:||||||.||..        |||:   |:......|:.||||..:||||.
 Frog   259 CLSVFALIGLQLFMGHLRNKCVRWPPEYEPNITSYFNETAGLYINVTLNPFNREEYILEETNFYF 323

Human   315 VPGMLEPLLCGNSSDAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLT 379
            :||..:.|||||||||||||:||.|:|.|||||||||||||||||||:||||||||:||||||||
 Frog   324 LPGTRDALLCGNSSDAGQCPKGYVCLKTGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLT 388

Human   380 LRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQE 444
            |||||||||||||||||:|||||:|||||||||||||||||||||||||||||:.|:|||||.||
 Frog   389 LRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQLMMEQLKKHQE 453

Human   445 EAQAAAMATSAGTVSEDAIEEEGEEG-GGSPRSSSEISKLSSKSAKERRNRRKKRKQKELSEGEE 508
            |.||||:|..   ..:.:.|..|..| ||...||||.||.|||||||||||||||||||..| :|
 Frog   454 EIQAAALAAE---TMDGSREFSGGTGYGGLSESSSEASKPSSKSAKERRNRRKKRKQKEQGE-DE 514

Human   509 KGDPEKVFKSESEDGMRRKAFR--LPDNRI--GRKFSIMNQSLLSIPGSPFLSRHNSKSSIFSFR 569
            |.|.||..||.||..::||.||  :..||:  .:|:|..:||.||..||.|..|.:|::|:.|||
 Frog   515 KADDEKFHKSASETSIKRKGFRFSIEGNRLTYEKKYSSPHQSRLSFRGSLFFPRRDSRASLCSFR 579

Human   570 GPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSRIFPSLR 634
            |.|  :|.||||:||||||||.|::|.||.|||:|.|..|||:     |..||.|::||..|.|.
 Frog   580 GRG--KDVGSENDFADDEHSTFEDNESRRGSLFVPHRHGERRN-----SNISQTSKASRTLPVLP 637

Human   635 RSVKRNSTVDCNGVVSLIGGPG--SHIGGRLLPE------------ATTEVEIKKKGPGSLLVSM 685
            .:.|.:|||||||||||:|||.  :...|.||||            ..||.|::|:...|..|||
 Frog   638 VNGKMHSTVDCNGVVSLLGGPSGPTSPAGLLLPEVIIDKPASDDNGTNTENELRKRRLSSYHVSM 702

Human   686 DQLASYGRKDRINSIMSVVTNTLVEELEESQRKCPPCWYKFANTFLIWECHPYWIKLKEIVNLIV 750
            |.|.....:.|..||.|.:|||: ||||||:.||||||.|||||:|||:|...|:|:|.:|||||
 Frog   703 DFLEDPILRQRALSIASNLTNTM-EELEESREKCPPCWNKFANTYLIWDCSDSWLKIKHVVNLIV 766

Human   751 MDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLAVGNLVFTGIFTAEMFLKLIAMDPYYYFQE 815
            ||||||||||||||||||||||||:|:|.:|...|.||||||||||||||..||||:|||||||.
 Frog   767 MDPFVDLAITICIVLNTLFMAMEHYPITDEFAGALNVGNLVFTGIFTAEMVFKLIALDPYYYFQV 831

Human   816 GWNIFDGFIVSLSLMELSLADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTL 880
            |||||||.|||||||||.|:|||||||||||||||||||||||||||||||||||||||||||||
 Frog   832 GWNIFDGVIVSLSLMELGLSDVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTL 896

Human   881 VLAIIVFIFAVVGMQLFGKSYKECVCKI-NQDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDC 944
            |||||||||||||||||||||||||||| ..|||||||||:||||||||||||||||||||||||
 Frog   897 VLAIIVFIFAVVGMQLFGKSYKECVCKIAPDDCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDC 961

Human   945 MEVAGQAMCLIVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDGEMNNLQISVIRIKKGVA 1009
            ||||||||||.||||||||||||||||||||||||||:||||||:||.|||||||:|.|:.:|:|
 Frog   962 MEVAGQAMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATEDDNEMNNLQIAVARMHEGIA 1026

Human  1010 WTKLKVHAFMQAHF--KQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGT--TSGI 1070
            :.|.|:..|:|..|  ||:..:|.|||:::..:|.:||:|||..:|.:..|:.|:||.|  ||||
 Frog  1027 YVKRKMREFIQNAFVKKQKALEETKPLEDMQNQKDSCISNHTTVEISKEYDYLKDGNVTTATSGI 1091

Human  1071 GSSVEKYIIDE-DHMSFINNPNLTVRVPIAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEG 1134
            ||||||||||| |:||||:||:|||.||||||||||||||||:.|||||.|.||:||:.:|||||
 Frog  1092 GSSVEKYIIDESDYMSFIHNPSLTVTVPIAVGESDFENLNTEEFSSESDLEESKEKLNSSSSSEG 1156

Human  1135 STIDIKP--EVEEVPVEQPEEYLDPDACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEH 1197
            ||:||:|  |.|.||..:.||:.:||||||:||::||.||.|::..|..|.||.|||||||||||
 Frog  1157 STVDIRPAGEGEPVPQVEVEEFQEPDACFTDGCIRRFPCCVVDVSHGKWKQWWNLRKTCFLIVEH 1221

Human  1198 NWFETFIIFMILLSSGALAFEDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWTAYGFVKFFTN 1262
            ||||||||||||:||||||||||||||||||:.|||||||||||||||||||||.||||.|:|||
 Frog  1222 NWFETFIIFMILMSSGALAFEDIYIEQRKTIKIILEYADKVFTYIFILEMLLKWVAYGFQKYFTN 1286

Human  1263 AWCWLDFLIVAVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSI 1327
            ||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog  1287 AWCWLDFLIVDVSLVSLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSI 1351

Human  1328 MNVLLVCLIFWLIFSIMGVNLFAGKYHYCFNETSEIRFEIEDVNNKTECEKLMEGNNTEIRWKNV 1392
            ||||||||||||||||||||:|:|||.||.|.|.::.|:...|||:::|..|:..|.| .|||||
 Frog  1352 MNVLLVCLIFWLIFSIMGVNMFSGKYGYCVNYTDDVVFDYTIVNNRSQCMDLISENKT-ARWKNV 1415

Human  1393 KINFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKPDEQPKYEDNIYMYIYFVIFIIFGSFFTLN 1457
            |:||||||.|||||||||||||||:||||||||||.:||||||||:|||:|||||||||||||||
 Frog  1416 KVNFDNVGFGYLALLQVATFKGWMEIMYAAVDSRKQEEQPKYEDNLYMYLYFVIFIIFGSFFTLN 1480

Human  1458 LFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFDFVTQQ 1522
            ||||||||||||||||||||||||||||||||||||||||||||||:|||.||.||.|||||::|
 Frog  1481 LFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPVPRPDNKFQGAVFDFVSKQ 1545

Human  1523 AFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHYYFTIGWNI 1587
            .|||.||:||||||||||:|||.||.:.||.|||||.||::.||.|||||:.:||||||||||||
 Frog  1546 PFDIAIMILICLNMVTMMIETDDQSIETENNLYWINAVFIVLFTGECVLKLISLRHYYFTIGWNI 1610

Human  1588 FDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALF 1652
            |||||||||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||
 Frog  1611 FDFVVVILSIVGMFLADLIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALF 1675

Human  1653 NIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLLPILNR 1717
            ||||||||||||::|||||||||||.|||||||||||||||||||||||||||||||||.||||.
 Frog  1676 NIGLLLFLVMFIYAIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNS 1740

Human  1718 -PPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFLIVVNMYIAIILENFSVATEESADPLS 1781
             .|||....||.||..|||||||||||||||||||||||:|||||||:|||||||||||||:||.
 Frog  1741 GAPDCDPKAEHSGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLG 1805

Human  1782 EDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLD 1846
            |||||.|||:|||||.:|||||:|.||.||||||:.|||:||||..:||||||||||||||||||
 Frog  1806 EDDFEMFYEVWEKFDSNATQFIQYVKLTDFADALDPPLRMPKPNNAQLIAMDLPMVSGDRIHCLD 1870

Human  1847 ILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYRGHLA 1911
            :||||||||||:..|:|.|||.|||||:||||||.||||||:||||||||::|:|:||.||.:..
 Frog  1871 VLFAFTKRVLGEGDEMDNLRQPMEERFMASNPSKASYEPITSTLRRKQEELAAIVIQRCYRCYAL 1935

Human  1912 RRG------------------FICKKTTSNKLENGGTHREKKESTPSTASLPSYDSVTKPEKEKQ 1958
            |:|                  .:.:|...:...||.:..||.:.||||.|.|||||||||:|||.
 Frog  1936 RKGIKHASFMYNQEKGKDGGSLLTRKDMLSDRLNGNSTTEKADITPSTTSPPSYDSVTKPDKEKH 2000

Human  1959 QRAEEGRRERAKRQKEVRESK 1979
               |:.:.|:..|.|:|||.|
 Frog  2001 ---EKDKIEKEDRGKDVREHK 2018

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN8ANP_001317189.1 I. {ECO:0000305} 114..442 278/339 (82%)
Ion_trans 131..421 CDD:306908 248/301 (82%)
Na_trans_cytopl 502..688 CDD:314757 96/204 (47%)
II. {ECO:0000305} 735..1007 238/273 (87%)
Ion_trans 752..965 CDD:306908 194/214 (91%)
Na_trans_assoc 991..1192 CDD:310839 124/208 (60%)
III. {ECO:0000305} 1180..1495 273/315 (87%)
Ion_trans 1197..1473 CDD:306908 238/276 (86%)
Na_channel_gate 1465..1517 CDD:240441 48/52 (92%)
IV. {ECO:0000305} 1504..1801 252/298 (85%)
Ion_trans 1522..1776 CDD:306908 221/255 (87%)
GPHH 1780..1843 CDD:318993 49/63 (78%)
IQ 1894..1915 CDD:197470 11/39 (28%)
scn3aXP_012826714.1 Ion_trans 151..430 CDD:278921 230/279 (82%)
Na_trans_cytopl 512..627 CDD:288761 61/123 (50%)
Ion_trans 786..982 CDD:278921 176/196 (90%)
Na_trans_assoc 1008..1216 CDD:284034 124/208 (60%)
Ion_trans 1239..1496 CDD:278921 221/258 (86%)
Na_channel_gate 1488..1540 CDD:240441 48/52 (92%)
Ion_trans 1562..1800 CDD:278921 207/238 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D37221at33208
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.