DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and CCH1

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:NP_011733.3 Gene:CCH1 / 853131 SGDID:S000003449 Length:2039 Species:Saccharomyces cerevisiae

Alignment Length:2331 Identity:423/2332 (18%)
Similarity:771/2332 (33%) Gaps:804/2332 (34%)


Human     4 SVLVPPGPDSFRFFTRESLAAIEQ-------RIAEEKAKRP----KQERKDEDDEN--------- 48
            |::.....|.|....:...:||::       ::..||: ||    .::|.:.:.|:         
Yeast   176 SLIAADDMDDFEDLQKGFKSAIDEEGLTWLPQLKSEKS-RPVSDVGEDRGEGEQESIPDVHTPNV 239

Human    49 -----------GPKP--NSDLEAG----------KSLPFIYGDIPPEMVSVPLEDLDPYYINKKT 90
                       .|:|  |..:..|          |..|..:..:.|:.     ||.|...:.:..
Yeast   240 GASATPGSIHLTPEPAQNGSVSEGLEGSINNSRKKPSPKFFHHLSPQK-----EDKDQTEVIEYA 299

Human    91 FIVLNKGKAISRFSATP------ALYILTPFNPIRKLAIKILVHSLFNML---------IMCTIL 140
            ..:|:......:..:.|      :|.:.:|.||:|....:.|:|..:::|         |:..|.
Yeast   300 EDILDFETLQRKLESRPFVLYGHSLGVFSPTNPLRIKIARFLLHRRYSLLYNTLLTFYAILLAIR 364

Human   141 T----NCVFM-TMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC-------------------- 180
            |    |.||: ..||   ||....:..:..:|...:.||:|.||.                    
Yeast   365 TYNPHNVVFLYRFSN---WTDYFIFILSACFTGNDIAKIIAFGFWDDSEMFKAYGREYKSILQRS 426

Human   181 ----------------LEDF-----------------------------------------TFLR 188
                            |.||                                         .|.|
Yeast   427 GIMKLYIYLREKYGRKLIDFIIPFRIISPGEETKYQRSSLSTSLTKPYGAKENQRPFGTPRAFAR 491

Human   189 DPWNWLDFTVITFAYVTEFVDLGNV---SALRTFR---VLRALKTISVIPGLKTIVGALIQSVKK 247
            ..||.:|.......::..|:.:.:.   :.:|.|:   :||.|:.::|..|:.:|:..|...:.:
Yeast   492 SSWNRIDLVSSVSFWLGMFLSIKSYDTKTGIRIFKPLAILRILRLVNVDTGMPSILRGLKYGIPQ 556

Human   248 LSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQW-----PPDNSSFEINITSFFNNSLDGNGTTF 307
            |.:|..:.|:....|.::|:|:|.|:.|.:|: |     |.|...:::.....:           
Yeast   557 LVNVSSMLVYFWIFFGILGVQIFQGSFRRQCV-WFNPEDPTDTYQYDMQFCGGY----------- 609

Human   308 NRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSW 372
                    .|...:.|.::.:.:|..     |:.|....||:...|| :..||..|..|||....
Yeast   610 --------LDPVTKRKQNYIYEDGSE-----GSVSKGFLCPQYSKCV-SNANPYNGRISFDNIVN 660

Human   373 AFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLE 437
            :...:|.:|:.:.:.:|...|:.:......:||::.||:.:.:|:||::||:..::|..|:    
Yeast   661 SMELVFVIMSANTFTDLMYYTMDSDEMAACLFFIVCIFVLTIWLLNLLIAVLVSSFEIANE---- 721

Human   438 EAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGIGVFSESSSVASKLSSKSEKELK 502
                   |:                                                        
Yeast   722 -------EY-------------------------------------------------------- 723

Human   503 NRRKKKKQKEQSGEEEKNDRVRKSESEDSIRRKGFRFSLEGSRLT-YEKRFSSPHQSLLSIRGSL 566
               ||||                              .:.|||.| |..|..:.:.....::.: 
Yeast   724 ---KKKK------------------------------FIYGSRKTGYVARIVTGYWKYFKLKAN- 754

Human   567 FSPRRNSRASLFSFRGRAKDIGSENDFADDEHSTFEDNDSRRDSLFVPHRHGERRHSNVSQASRA 631
                                                                :.:..|.||...|
Yeast   755 ----------------------------------------------------QTKFPNWSQKGLA 767

Human   632 SRVLPILPMNGKMHSAVDCNGVVSLVGGPSTLTSAGQLLPEGTTTETEIRKRRSSSYHVSMDLLE 696
                        ::|.|:...|:.::                    .:|..|             
Yeast   768 ------------IYSHVEFIFVILII--------------------CDIGMR------------- 787

Human   697 DPTSRQRAMSIASILTNTMEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFV 761
                       ||:..:|.                 ||      |....||....:::|:   |:
Yeast   788 -----------ASVKVSTS-----------------AN------CNNILLKTDRGISIVL---FI 815

Human   762 DLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIF 826
            :                             |:..||   ::...|: |.:....|.|        
Yeast   816 E-----------------------------SLARLV---LYLPNMW-KFLTKPSYVY-------- 839

Human   827 DGFIVSLSLMELGLANVEG--------LSVL---RSFRLLRVFKLAKS-WPTLNMLIKIIGNSVG 879
             .||:|:..:.:....|||        ||:.   |.:|::..|.|.|. |.      :|:.|.| 
Yeast   840 -DFIISIITLVISCLAVEGVLGHMYAWLSIFHISRFYRVIISFNLTKKLWK------QILSNGV- 896

Human   880 ALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGE-W 943
            .:.||:.......|:.|:: |.:    |.|.|.......:.| :.|:...:|||.:|.:...| |
Yeast   897 MIWNLSSFYFFFTFLVAII-MAV----YFEGVIPPEEMADQP-FGMYSLPNSFLSLFIIGSTENW 955

Human   944 IETMWDCME----VAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQ 1004
            .:.::...:    ::....|...|::..::.|.|:||:|:||:     |:::...:::....   
Yeast   956 TDILYALQKHSPNISSTFFCSVFFIIWFLLSNSVILNIFIALI-----SESMEVKEEEKRPQ--- 1012

Human  1005 IAVGRMQKGIDFV-KRKIREFIQKAFV-RKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNY 1067
                :::..:.|| .:||:|:...:.| |.:|........||..:.|...:.....:.|.:::..
Yeast  1013 ----QIKHYLKFVYPQKIQEYTHASLVARIRKKFFGGHRNEDTRDFKQFLMRGTAIMNIAQNMGE 1073

Human  1068 LKDGNGTTSGIGSSVEKYVVDESDYMSFINNPS----------LTVTVPIAVGESDFENLNTEEF 1122
            |.|                       .|...||          ||:.||.......|.|   ..|
Yeast  1074 LAD-----------------------EFKEPPSENLFKKGLSKLTIGVPSLKRLRMFAN---NPF 1112

Human  1123 SSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEVEPEE---------------SLEPEACFT 1172
            ...||:     ....|:...|.|..:      |..|.|.|:               ...|:..| 
Yeast  1113 YKNSDV-----VFTETNDINGRTYIL------ELNEYEDEKLDYLKKYPLFNYSYYFFSPQHRF- 1165

Human  1173 EDCVRKFKCCQISIEEGKGKL------------WWNLRKTCYKIVEHNWFETFIVFMILLSSGAL 1225
                |:|  ||..:....||.            .:| :::.:..:|.:.|    ||:..|::..|
Yeast  1166 ----RRF--CQRLVPPSTGKRTDGSRFFEDSTDLYN-KRSYFHHIERDVF----VFIFALATILL 1219

Human  1226 AFEDIYI------EQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGF----QVYFTNAWCWLDFL 1280
            .....|:      ..:..........|..|...|.:|.::|.||.||    ..|..|.|.::||.
Yeast  1220 IVCSCYVTPLYRMHHKMGTWNWSSALDCAFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDFC 1284

Human  1281 IVDVSLVSLTANALGY----SELGAIKSLRTLRALRPLRALSRFEGMRVVVN-ALLGAIPSIMNV 1340
            :    |:|:..|.:.|    ..|..|  .:.|.|||.||.|:.....|...| .:...:..|...
Yeast  1285 V----LISMWINLIAYLKNNGNLSRI--FKGLTALRALRCLTISNTARQTFNLVMFDGLNKIFEA 1343

Human  1341 LLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARW------- 1398
            .|:.|.....|::.|:::|.|:...|   ..|.:......|.|        ||...:|       
Yeast  1344 GLISLSLLFPFTVWGLSIFKGRLGTC---NDGSLGRADCYNEY--------SNSVFQWDIMSPRV 1397

Human  1399 -KNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSF 1462
             :...::.|:....:.||.|:.:.:||:|::...::|..:........:....|:.|:|......
Yeast  1398 YQQPYLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMV 1462

Human  1463 FTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDF 1527
            |.||||:..|::|   |.:..|  ..:.|.|:|.:..:.|.|...|| |.||......:...|.:
Yeast  1463 FILNLFVSFIVNN---QARTTG--SAYFTIEEKAWLESQKLLSQAKP-KAIPNLIELSRVRQFFY 1521

Human  1528 ---VTKQVFDIS--IMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRY 1587
               |.|:.|..:  :.:::.|:::.::    .:|....|::.:..:.|  :|:....|...:|..
Yeast  1522 QLAVEKKNFYYASFLQVVLYLHIIMLL----SRSYNPGNLIGYQGVYF--MFSTSVFLIQEALHM 1580

Human  1588 ------YYFTIGWNIFDFVVVILSIV-------------------GMFLAELIEKYFVSP---TL 1624
                  .||...||.....::|::.:                   |.||  |:...|:.|   ||
Yeast  1581 CGEGPRLYFRQKWNSIRLSIIIIAFIMNAVAFHVPASHYWFHNIKGFFL--LVIFLFIIPQNDTL 1643

Human  1625 FRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREV 1689
            ..::..|                      |.|||.:.::.....::..:|||.....|...:...
Yeast  1644 TELLETA----------------------MASLPPILSLTYTWGVLFLVYAIALNQIFGLTRLGS 1686

Human  1690 GIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKDHPGSSVKGDCGNPSVGIF 1754
            ...|..||.|...|||.||:.:...||:.::|. |....|.|..|    .:|...|||:.:....
Yeast  1687 NTTDNINFRTVIKSMIVLFRCSFGEGWNYIMAD-LTVSEPYCSSD----DNSTYTDCGSETYAYL 1746

Human  1755 FFVSYIIISFLVVVNMYIAVILENFSVATEE--SAEPLSEDDFEMFYEVWEKFDPDATQFIEFAK 1817
            ..:|:.|||..:.|||::::|:.|||.....  |...::..:.:.:.|.|.|||.|.|..:|.:.
Yeast  1747 LLMSWNIISMYIFVNMFVSLIIGNFSYVYRSGGSRSGINRSEIKKYIEAWSKFDTDGTGELELSY 1811

Human  1818 LSDFADALDPPL------------------LIAKPN-----KVQLIAMDLPMVSGDRIHCLDILF 1859
            |.....:.|.||                  :...|:     |:.||.::..:.:.|:...:.   
Yeast  1812 LPRIMHSFDGPLSFKIWEGRLTIKSLVENYMEVNPDDPYDVKIDLIGLNKELNTIDKAKIIQ--- 1873

Human  1860 AFTKRVLGESGEMDALRIQMEERFMASNPSKVSYE------------PITTTLKRKQ-----EEV 1907
                            |.....||:.|.....:|.            |:.|....::     :.|
Yeast  1874 ----------------RKLQYRRFVQSIHYTNAYNGCIRFSDLLLQIPLYTAYSARECLGIDQYV 1922

Human  1908 SAIIIQRAYRRYLLKQKVKKVSSI----------YKKDKGKECDGTPIKEDTL---IDKLNENST 1959
            ..:.|.....:||..|:...|..:          .|:....|.|   :|:.|:   |..:|.|..
Yeast  1923 HHLYILGKVDKYLENQRNFDVLEMVVTRWKFHCRMKRTIEPEWD---VKDPTVSSHISNINVNLE 1984

Human  1960 PEK--TDMTPSTTSPPSY-------------DSVTKPEKEKFEKDKSEKEDKGKDI 2000
            |..  .:..|..|....|             ||..:|.:|..:.:    :|...|:
Yeast  1985 PAPGILEREPIATPRMDYGVNNFMWSPRMNQDSTMEPPEEPIDNN----DDSANDL 2036

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456 85/447 (19%)
Ion_trans 150..435 CDD:278921 70/373 (19%)
Na_trans_cytopl 514..630 CDD:288761 9/117 (8%)
II. {ECO:0000305} 741..1013 55/289 (19%)
Ion_trans 776..971 CDD:278921 42/212 (20%)
Na_trans_assoc 997..1203 CDD:284034 42/245 (17%)
III. {ECO:0000305} 1190..1504 77/349 (22%)
Ion_trans 1225..1482 CDD:278921 64/280 (23%)
Na_channel_gate 1474..1526 CDD:240441 14/52 (27%)
IV. {ECO:0000305} 1513..1811 74/333 (22%)
Ion_trans 1548..1786 CDD:278921 59/268 (22%)
GPHH 1798..1853 CDD:293510 17/78 (22%)
CCH1NP_011733.3 Ion_trans 486..722 CDD:278921 58/273 (21%)
Ion_trans 795..1010 CDD:278921 57/301 (19%)
Ion_trans 1228..1480 CDD:278921 62/272 (23%)
Ion_trans 1566..1776 CDD:278921 56/239 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I511
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.952 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.