DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and para

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:NP_001259619.1 Gene:para / 32619 FlyBaseID:FBgn0285944 Length:2145 Species:Drosophila melanogaster

Alignment Length:2160 Identity:973/2161 (45%)
Similarity:1319/2161 (61%) Gaps:282/2161 (13%)


Human    14 FRFFTRESLAAIEQRIAEEKAKRPKQERK---------------------DEDDENGPKPNSDLE 57
            ||.||||||..||||||.|..|:.:.|||                     |||::.||:|:..||
  Fly    16 FRPFTRESLVQIEQRIAAEHEKQKELERKRAEGEVPQYGRKKKQKEIRYDDEDEDEGPQPDPTLE 80

Human    58 AGKSLPF-IYGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRKL 121
            .|..:|. :.|..|||:.|.||||:||||.|..||:|::|||.|.||||:.|:::|.||||||::
  Fly    81 QGVPIPVRLQGSFPPELASTPLEDIDPYYSNVLTFVVVSKGKDIFRFSASKAMWMLDPFNPIRRV 145

Human   122 AIKILVHSLFNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTF 186
            ||.||||.||::.|:.|||.||:.|.|...|. .::.|..|||||||||.:|::||||.|..||:
  Fly   146 AIYILVHPLFSLFIITTILVNCILMIMPTTPT-VESTEVIFTGIYTFESAVKVMARGFILCPFTY 209

Human   187 LRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDV 251
            |||.||||||.||..||||..:||||::|||||||||||||::::|||||||||:|:|||.|.||
  Fly   210 LRDAWNWLDFVVIALAYVTMGIDLGNLAALRTFRVLRALKTVAIVPGLKTIVGAVIESVKNLRDV 274

Human   252 MILTVFCLSVFALIGLQLFMGNLRNKCL-QWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFN 315
            :|||:|.||||||:|||::||.|..||: ::|.|.|         :.|..|.|....||..|  |
  Fly   275 IILTMFSLSVFALMGLQIYMGVLTQKCIKKFPLDGS---------WGNLTDENWDYHNRNSS--N 328

Human   316 WDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKA-GRNPNYGYTSFDTFSWAFLSLFR 379
            |  |.||:...:        .||||.|.||||.:.|:|::. |.||||||||||:|.|||||.||
  Fly   329 W--YSEDEGISF--------PLCGNISGAGQCDDDYVCLQGFGPNPNYGYTSFDSFGWAFLSAFR 383

Human   380 LMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEE-QNQATLEEAEQKE 443
            ||||||||:||||.|||||..:|:||:::||||||||:|||||:|||:|:| |.:|..|||.::|
  Fly   384 LMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFLGSFYLVNLILAIVAMSYDELQKKAEEEEAAEEE 448

Human   444 AEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGIGVFSESSSVASKLSSKSEKELKNRRKKK 508
            |         .::.||| |||.||..|.|          .:..:..|:..::..|..|.....|.
  Fly   449 A---------IREAEEA-AAAKAAKLEER----------ANAQAQAAADAAAAEEAALHPEMAKS 493

Human   509 K-------QKEQSGEEEKNDRVRKSESEDSIRRKGFRFSLEGSRLTYEKRFSSP---HQSL---- 559
            .       :....||:..:|..::..|..|:       .:|...::..:|..:|   ||:.    
  Fly   494 PTYSCISYELFVGGEKGNDDNNKEKMSIRSV-------EVESESVSVIQRQPAPTTAHQATKVRK 551

Human   560 -----LSIRGSLFSPRRNSRAS----LFSFRGRAKDIGSEN---------------DFADDEHST 600
                 ||:.||.|:.||.||:|    :.:.|||....||:.               .:|||.::.
  Fly   552 VSTTSLSLPGSPFNIRRGSRSSHKYTIRNGRGRFGIPGSDRKPLVLSTYQDAQQHLPYADDSNAV 616

Human   601 ---FEDNDSRRDSLFVPHRHGE--RRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGP 660
               .|:|    .::.||..:|.  .|||  |..|..||:        ...|..|..|.:::: |.
  Fly   617 TPMSEEN----GAIIVPVYYGNLGSRHS--SYTSHQSRI--------SYTSHGDLLGGMAVM-GV 666

Human   661 STLTSAGQLLPE------------GTTTETEIRKRRSSSYHVSMDLLE-------------DPTS 700
            ||:|...:|...            |||......|.....|.:.::..:             :|..
  Fly   667 STMTKESKLRNRNTRNQSVGATNGGTTCLDTNHKLDHRDYEIGLECTDEAGKIKHHDNPFIEPVQ 731

Human   701 RQRA--MSIASILTNTMEE-------------------LEESRQKCPPCWYKFANMCL------- 737
            .|..  |....:|.:.:|:                   .|:..:..|....|...:.|       
  Fly   732 TQTVVDMKDVMVLNDIIEQAAGRHSRASDRGVSVYYFPTEDDDEDGPTFKDKALEVILKGIDVFC 796

Human   738 IWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIF 802
            :||||..|||.:..|:|:|.||||:|.||:|||:||:||||:|:.|.::...||..||..||..|
  Fly   797 VWDCCWVWLKFQEWVSLIVFDPFVELFITLCIVVNTMFMAMDHHDMNKEMERVLKSGNYFFTATF 861

Human   803 TAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTL 867
            ..|..:|::||.|.|||||||||||..||:|||:||||..|:|||||||||||||||||||||||
  Fly   862 AIEATMKLMAMSPKYYFQEGWNIFDFIIVALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTL 926

Human   868 NMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSF 932
            |:||.|:|.::|||||||.||.||:|||||:|||||||:|.:...:.. |.:||||:..||.|||
  Fly   927 NLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKDRFP-DGDLPRWNFTDFMHSF 990

Human   933 LIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDD 997
            :||||||||||||:|||||.| |...|:..|:..:|||||||||||||||||:|.|.:|:|...|
  Fly   991 MIVFRVLCGEWIESMWDCMYV-GDVSCIPFFLATVVIGNLVVLNLFLALLLSNFGSSSLSAPTAD 1054

Human   998 NEMNNLQIAVGRMQKGIDFVKRKIREFIQKAFVRKQKALDEI--KPLEDLNNKKD---------- 1050
            |:.|.:..|..|:.:...:|||.|.:..:   :.:.|..::|  :|..:..|:..          
  Fly  1055 NDTNKIAEAFNRIGRFKSWVKRNIADCFK---LIRNKLTNQISDQPSGERTNQISWIWSEGKGVC 1116

Human  1051 SCIS---NHTTIEIGKDLNYLKDG---NGTTS------GIGSSVEKYVV------DESDYMSFIN 1097
            .|||   ....:|:|.| ..|.||   .|...      .||..:| :.:      ::.....::|
  Fly  1117 RCISAEHGDNELELGHD-EILADGLIKKGIKEQTQLEVAIGDGME-FTIHGDMKNNKPKKSKYLN 1179

Human  1098 NPSLTVTVPI-AVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEVE- 1160
            |.:...|..| :.|.........|.....::..|.:||.:|:....|...::....|.|:..:: 
  Fly  1180 NATDDDTASINSYGSHKNRPFKDESHKGSAETMEGEEKRDASKEDLGLDEELDEEGECEEGPLDG 1244

Human  1161 -------PEESLE--PEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVF 1216
                   .|:.|:  |..|..:...:||.......:....:.|.|||...::::|:.:|||.::.
  Fly  1245 DIIIHAHDEDILDEYPADCCPDSYYKKFPILAGDDDSPFWQGWGNLRLKTFQLIENKYFETAVIT 1309

Human  1217 MILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLI 1281
            |||:||.|||.||:::.||..::.:|.|.|::||.||.||||:||:|.||:||||||||||||:|
  Fly  1310 MILMSSLALALEDVHLPQRPILQDILYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCWLDFVI 1374

Human  1282 VDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLI 1346
            |.|||::..|:.:|...:.|.|::|||||||||||:||.:|||||||||:.|||||.||||||||
  Fly  1375 VMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQGMRVVVNALVQAIPSIFNVLLVCLI 1439

Human  1347 FWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLG 1411
            |||||:||||.|||||::.|.: ..|......::.|.:.|::   .|.|  |.|..:|||:||..
  Fly  1440 FWLIFAIMGVQLFAGKYFKCED-MNGTKLSHEIIPNRNACES---ENYT--WVNSAMNFDHVGNA 1498

Human  1412 YLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNF 1476
            ||.|.||||||||:.||..|:|||.|:.||..|.|:|||||||.|||||||||||||||||||||
  Fly  1499 YLCLFQVATFKGWIQIMNDAIDSREVDKQPIRETNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNF 1563

Human  1477 NQQKKKFGGQ-DIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMIL 1540
            |:||||.||. ::||||:||||||||||:|||||.|.||||..:.|.:||:.||.:.|||.||:.
  Fly  1564 NEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVFEIVTDKKFDIIIMLF 1628

Human  1541 ICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILS 1605
            |.|||.||.::..|.|.....:|.::|.:|:|:|:.||:||:.:|||:||...||:||.||||||
  Fly  1629 IGLNMFTMTLDRYDASDTYNAVLDYLNAIFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILS 1693

Human  1606 IVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLV 1670
            |:|:.|:::||||||||||.||:|:|::||:|||:|||||||||||||.|||||||||.||||||
  Fly  1694 ILGLVLSDIIEKYFVSPTLLRVVRVAKVGRVLRLVKGAKGIRTLLFALAMSLPALFNICLLLFLV 1758

Human  1671 MFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDP-- 1733
            |||:||||||.|.:||.:.||:|::||:|||.|||.|||::|||||||:|..|:|.  ..|||  
  Fly  1759 MFIFAIFGMSFFMHVKEKSGINDVYNFKTFGQSMILLFQMSTSAGWDGVLDAIINE--EACDPPD 1821

Human  1734 -DKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEM 1797
             ||.:|     |:||:.:|||.|.:||::||||:|:||||||||||:|.|||:..|.|::||::|
  Fly  1822 NDKGYP-----GNCGSATVGITFLLSYLVISFLIVINMYIAVILENYSQATEDVQEGLTDDDYDM 1881

Human  1798 FYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFT 1862
            :||:|::|||:.||:|.:.:||:|.|.|:|||.|.||||.::|:||:|:..||.::|:|||.|.|
  Fly  1882 YYEIWQQFDPEGTQYIRYDQLSEFLDVLEPPLQIHKPNKYKIISMDIPICRGDLMYCVDILDALT 1946

Human  1863 K-------RVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYL 1920
            |       ..:.|:||:..:         |:.|....|||:::||.|::||..|.:||.|:|   
  Fly  1947 KDFFARKGNPIEETGEIGEI---------AARPDTEGYEPVSSTLWRQREEYCARLIQHAWR--- 1999

Human  1921 LKQKVK-KVSSIYKKDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTSPPSYDSVTKPEKE 1984
             |.|.: :....::.|......|.|...|...|:..:...|...|.:.:.|:..:.|:       
  Fly  2000 -KHKARGEGGGSFEPDTDHGDGGDPDAGDPAPDEATDGDAPAGGDGSVNGTAEGAADA------- 2056

Human  1985 KFEKDKSEKEDKGKD 1999
                |:|.....|:|
  Fly  2057 ----DESNVNSPGED 2067

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456 197/348 (57%)
Ion_trans 150..435 CDD:278921 169/288 (59%)
Na_trans_cytopl 514..630 CDD:288761 38/152 (25%)
II. {ECO:0000305} 741..1013 168/272 (62%)
Ion_trans 776..971 CDD:278921 124/195 (64%)
Na_trans_assoc 997..1203 CDD:284034 49/247 (20%)
III. {ECO:0000305} 1190..1504 190/315 (60%)
Ion_trans 1225..1482 CDD:278921 159/257 (62%)
Na_channel_gate 1474..1526 CDD:240441 37/53 (70%)
IV. {ECO:0000305} 1513..1811 178/301 (59%)
Ion_trans 1548..1786 CDD:278921 147/241 (61%)
GPHH 1798..1853 CDD:293510 28/55 (51%)
paraNP_001259619.1 Ion_trans 165..436 CDD:278921 171/293 (58%)
Na_trans_cytopl 515..648 CDD:288761 36/146 (25%)
Ion_trans 835..1028 CDD:278921 124/195 (64%)
Na_trans_assoc 1054..1296 CDD:284034 49/247 (20%)
Ion_trans 1318..1571 CDD:278921 160/259 (62%)
Na_channel_gate 1561..1613 CDD:240441 36/52 (69%)
Ion_trans 1636..1871 CDD:278921 147/242 (61%)
GPHH 1880..1930 CDD:293510 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 1 1.000
Homologene 1 1.000 H75001
Inparanoid 1 1.050 1627 1.000 Inparanoid score I80
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D37221at33208
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 1 1.000 T608898
orthoMCL 1 0.900 OOG5_126819
Panther 1 1.100 O PTHR10037
Phylome 1 0.910 0.952 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9280
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.