DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and cch1

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:NP_593894.1 Gene:cch1 / 2542812 PomBaseID:SPAC6F6.01 Length:1854 Species:Schizosaccharomyces pombe

Alignment Length:2110 Identity:404/2111 (19%)
Similarity:750/2111 (36%) Gaps:695/2111 (33%)


Human    63 PFIYGDIPPEMVSVPLEDLDPYYIN--KKTFIVLNKGKAISRFSATPALYILTPFNPIRKLAIKI 125
            ||::            :.|.||:.:  .:.:..:.:.....|.:.||...:  ||:||.:   :|
pombe   134 PFLF------------DKLSPYFTHFFSEIYAAVLRVVGPPRANETPGRNL--PFSPILR---QI 181

Human   126 LVHSLFNMLIMCTILTNCVFMTM--SNPPDWTKNVEYTFTGI---YTFESLIKILARGFCLE--- 182
            ..|.|:|:.|...|:.:.|.:.:  .:|.|.::.::|....|   ||.|.|:||...||..:   
pombe   182 YNHPLYNIFIFVVIVLHAVLLMIRSDDPHDKSQTIDYLIIVIGILYTLEMLLKIYLFGFLYDGSS 246

Human   183 ---DF------------TFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRV---LRALKTIS 229
               ||            ::||..||.:||..|...::: .:........|.|.:   ||..:.::
pombe   247 SFYDFINSYTKKTPRTMSYLRHSWNRVDFVAIVALWIS-VIGKKQQGIFRLFSMIACLRLTRLLN 310

Human   230 VIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITS 294
            :....:||:.:|.:|...|..|:....|...:.|::|:|.|..:|..:|: |..|.....:....
pombe   311 ITRKTETILKSLKESSTPLVQVVSFNAFFGVMIAILGVQFFKASLNRQCV-WLGDYGDQYLPTGQ 374

Human   295 FFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAG-- 357
            |...                :|:            .|...|.|..|...:...|.|:||.:..  
pombe   375 FCGG----------------HWE------------NGIKRAYLDKNGFPSNVNPRGFICAEKSVC 411

Human   358 ---RNPNYGYTSFDTFSWAFLSLFRLMTQD-FWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLIN 418
               .||.....|||.|..:...:|.:|:.: |.:.:|.:.......:.::|.:...|| :.:|::
pombe   412 RVVENPYSNTVSFDNFFNSLELIFVIMSSNGFTDIMYDIMDAEYFVSCLLFIISAYFL-TLWLMS 475

Human   419 LILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGIGVF 483
            |::|||..::                                           .|...:|     
pombe   476 LVIAVVTSSF-------------------------------------------IDLQHSG----- 492

Human   484 SESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKNDRVRKSESEDSIRRKGFRFSLEGSRLTY 548
                                    |.||||           ||..:..||.|           ..
pombe   493 ------------------------KNQKEQ-----------KSVDKHLIRNK-----------LC 511

Human   549 EKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHSTFEDNDSRRDSLFV 613
            ||                                                           .|| 
pombe   512 EK-----------------------------------------------------------YLF- 516

Human   614 PHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGPSTLTSAGQLLPEGTTTET 678
                    :||                                                      
pombe   517 --------YSN------------------------------------------------------ 519

Human   679 EIRKRRSSSYHVSMDLLEDPTSRQRAMSIASILTNTMEELEESRQKCPPCWYKFANMCLIWDCCK 743
                                                                      .||    
pombe   520 ----------------------------------------------------------FIW---- 522

Human   744 PWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGN--LVFTG----IF 802
                    ::.:|..     .:|:|               |:.:....|..|  |:|..    :.
pombe   523 --------ISFIVAQ-----FVTLC---------------TQTYDQTSSTANRYLIFYACVDFLL 559

Human   803 TAEMFLKIIAMDPYY--YFQEGWNIFDGFIVSLSLMELGLANVEGLSV----LRSFRLLRVFKLA 861
            .||:.|:..|..|.|  :|:...|:.|..:..|:|:.| |.::....|    |..|.:.|:::..
pombe   560 AAEVILRFFAYLPDYRLFFRRYTNLVDIVLAVLNLVTL-LPSIRKNPVAFGWLSIFAIARIYRCI 623

Human   862 KSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF------GKSYKECVCKISNDCEL 920
            ...|....:.|::.::...|.||.|.|.|::||.::..::||      |.|..:.:...:.    
pombe   624 LLIPYTRKIAKLLFSNFKQLLNLMLFLVIVLFIASLCAVRLFQDLPNDGDSDDDAISFATT---- 684

Human   921 PRWHMHDFFHSFLIVFRVLCGE-WIETM-------------WDCMEVAGQTMCLTVFMMVMVIGN 971
                    :.|||.::::|..| |.:.|             |    :.|     ..|.:..:..|
pombe   685 --------YESFLYMYQILTSENWTDVMFAIQARLAHLHLSW----IPG-----AFFTLWFLFSN 732

Human   972 LVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRK--IREFIQKAFVRKQK 1034
            .|||::|:|::     ..|.|.::.|.:|..|::.:.|:.:..:..:..  :...|::...||.|
pombe   733 NVVLSMFIAVI-----QVNFAPSESDLKMEQLKMYLARLLRNYNPFQASLTLNALIKRNGSRKGK 792

Human  1035 ALDE--------------------IKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIG 1079
            .:||                    |.|.|.|....|      |:.|:.|   |      :.:.:.
pombe   793 TVDESHYEWLYEDNIIKGFLRVTNIPPKEPLKPSLD------TSPELSK---Y------SLAKLS 842

Human  1080 SSVEKYVVDESDYMSFINNPSLTVTVPIAVG---ESDFENLNTEEFSSESDMEESKEKLNATSSS 1141
            ::.:::|:.:        :|.........:|   |.|. ||.|    :..||:.:|..:      
pombe   843 NNFKRFVMRD--------DPFSQAYFKRVIGIRWEKDM-NLKT----AAKDMQAAKAFV------ 888

Human  1142 EGSTVDIGAPAEGEQPEVEPEESLEPEACFTE--------DCVRKFKCCQISIEEGKGKLWWNLR 1198
                            .::..|.|:....:.:        :.:|:|  ||..:..|..:.:..:.
pombe   889 ----------------RIKQTEFLKNHPKYNDVFWVIKPSNRIRRF--CQRLVMPGVNERYGGVE 935

Human  1199 --KTCYKIVEHNWFETFIVFMILLSSGALAFEDIY--IEQRKTIKTMLEYA-----DKVFTYIFI 1254
              :..|:::     :.||...||.   |:..|.|.  |.:|..:....::|     :..|..||.
pombe   936 PYQWVYRVI-----QVFIYACILT---AVIIECIATPIYERDHLLNDKQHAWFVWTEVAFATIFT 992

Human  1255 LEMLLKWVAYGF----QVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLR 1315
            :|..:|.:|.||    ..|..:.|..:||.::....::|.|....::.|.  ::.|..:|||.||
pombe   993 IEAAIKIIADGFCITPNAYLRSTWNCIDFFVLVTLWINLYAVLTSHALLS--RAFRAFKALRVLR 1055

Human  1316 ALSRFE-GMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSV 1379
            .::..: ..|:..:||:.....|.:..:|.....:.|::...|:|.|..|.|        .|.:|
pombe  1056 LINLTQTSQRMFHDALISGFFKIFSAAVVSATLLIPFALWAKNVFGGLLYSC--------NDDNV 1112

Human  1380 VNNYSECKALIESNQTAR---------WKN-VKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDS 1434
            : :.|:|  ::|...|..         |.| ...:||......|:|.::|:.:||:|||.:.:|.
pombe  1113 L-SASQC--VLEYASTPNNWEVWAPRVWSNPPDYDFDRFPHALLALFEIASIEGWVDIMRSVMDI 1174

Human  1435 RNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYN 1499
            .....||:...:....::||:|.:....:.|.|||.:||.|:.::.     ...|.|.||:.:..
pombe  1175 TGFNNQPQTNASSGNAMFFVLFNLVSMIYILTLFIAIIISNYAERT-----GSAFFTAEQRAWLE 1234

Human  1500 AMKKLGSKKPQK-PIPRPANKFQGMVFDFVTKQ----------VFDISIMILICLNMVTMMVETD 1553
            ..:|:.|.:|.| |..||.. .:|:.:||..::          ::.:.::.|:.:.....:..| 
pombe  1235 LRRKIKSMRPSKRPAIRPLG-LRGLCYDFAVQKHGIWRRTFTGLYIVHLLFLLTIFYPCPIAYT- 1297

Human  1554 DQSQEMTNILYWINLVFIVL---FTGECVLKLISLRYYYFTIG-WNIFDFVVVILSIVGMFLAEL 1614
                      |..|.:|::|   :|....:|:..|.:|||... ||:|| |||.|..:...:|.|
pombe  1298 ----------YVRNSIFLILSICYTINICVKVYGLSFYYFFHSFWNMFD-VVVTLGSLTCNIAIL 1351

Human  1615 IEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFI-YAIFG 1678
            .:....|.||.:...|..:  .:.||........|...::.|||::|:: :..::|::| :||..
pombe  1352 AKFENRSLTLLQTTLLVLV--TVHLIPKFDNFDQLSKTVVASLPSIFSL-IATWIVLYITFAIAF 1413

Human  1679 MSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKDHPGSSVK 1743
            ...|...|..:......||.:..|:::.||.:|...||:.::.....| .|:|....|...|   
pombe  1414 NQIFGLTKLGLNGGPNKNFRSIRNALVLLFTMTFGEGWNDVMHDYTIS-YPNCVNGDDFYNS--- 1474

Human  1744 GDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFS-VATEESA-EPLSEDDFEMFYEVWEKFD 1806
             ||||.......|:::.|||..:.|||:|.|:.:||| :.|:.|: ..|..:||..|.:.|..||
pombe  1475 -DCGNKPWAYGLFIAWNIISMYIFVNMFITVVFDNFSYIHTKSSSFTNLQRNDFRQFKDSWAPFD 1538

Human  1807 PDATQFI----------EFAKLSDFADALDPPLLIAKPNKVQ-------LIAMDLPMVSGD-RIH 1853
            |..|.:|          ....:.||....|...|.:..:|||       :..::.|::..: .:.
pombe  1539 PMVTGYIPKRNAVKFVLSLRGVYDFRIYRDEHTLRSIISKVQSKTGQQSVPMLENPLMGSEINLE 1603

Human  1854 CLD----------------ILFAFTKRVLGESGEMDALR-----------IQMEERFMASNPSKV 1891
            .||                :|.:....::...|.:.:..           :...|.|..|:..:.
pombe  1604 ALDQIIDTIDVNVVKERRNVLNSLCTEIMTLPGNVISFSNILMLVVLHKIVDHREAFPISDYIRR 1668

Human  1892 SYEPITTTLKR--KQEE----VSAIIIQRAYRRYLLKQK---------VKKVSSIYKKDKGKECD 1941
            :|  :.:.|::  :.|:    |...||::.:.:::.::|         :.:||.|..:       
pombe  1669 AY--VLSELEKSIRMEKLLGLVETSIIRKTFLQHMEEKKKALENPFILLSEVSEILPE------- 1724

Human  1942 GTPIKEDTLIDKLNENSTPEKTDMTPSTTS 1971
             |||:|..    ...|:.||:..|:..|.|
pombe  1725 -TPIQEVL----RQHNADPEQLLMSTRTPS 1749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456 79/377 (21%)
Ion_trans 150..435 CDD:278921 68/315 (22%)
Na_trans_cytopl 514..630 CDD:288761 11/116 (9%)
II. {ECO:0000305} 741..1013 61/304 (20%)
Ion_trans 776..971 CDD:278921 46/227 (20%)
Na_trans_assoc 997..1203 CDD:284034 38/241 (16%)
III. {ECO:0000305} 1190..1504 79/338 (23%)
Ion_trans 1225..1482 CDD:278921 68/279 (24%)
Na_channel_gate 1474..1526 CDD:240441 13/53 (25%)
IV. {ECO:0000305} 1513..1811 84/315 (27%)
Ion_trans 1548..1786 CDD:278921 68/244 (28%)
GPHH 1798..1853 CDD:293510 15/73 (21%)
cch1NP_593894.1 Ion_trans 201..485 CDD:278921 68/315 (22%)
Ion_trans 533..748 CDD:278921 54/257 (21%)
Ion_trans 968..1220 CDD:278921 65/265 (25%)
Ion_trans 1289..1517 CDD:278921 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.966 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.