DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and Scn2a

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:NP_036779.1 Gene:Scn2a / 24766 RGDID:3632 Length:2005 Species:Rattus norvegicus

Alignment Length:2006 Identity:1960/2007 (98%)
Similarity:1984/2007 (99%) Gaps:2/2007 (0%)


Human     1 MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSLPFI 65
            ||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MARSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSLPFI 65

Human    66 YGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRKLAIKILVHSL 130
            ||||||||||.||||||||||||||||||||||||||||||.|||||||||||||||||||||||
  Rat    66 YGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSL 130

Human   131 FNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLD 195
            ||:|||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||||
  Rat   131 FNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRNPWNWLD 195

Human   196 FTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLS 260
            |||||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   196 FTVITFAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLS 260

Human   261 VFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSH 325
            ||||||||||||||||||||||||||:||||||||||||||.|||.|||||::||||||||||||
  Rat   261 VFALIGLQLFMGNLRNKCLQWPPDNSTFEINITSFFNNSLDWNGTAFNRTVNMFNWDEYIEDKSH 325

Human   326 FYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLY 390
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   326 FYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLY 390

Human   391 QLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKK 455
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   391 QLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKK 455

Human   456 QQEEAQAAAAAASAESRDFSGAGGIGVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKN 520
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||.
  Rat   456 QQEEAQAAAAAASAESRDFSGAGGIGVFSESSSVASKLSSKSEKELKNRRKKKKQKEQAGEEEKE 520

Human   521 DRVRKSESEDSIRRKGFRFSLEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAK 585
            |.||||.||||||:|||:||||||||||||||||||||||||||||||||||||||||:|:||.|
  Rat   521 DAVRKSASEDSIRKKGFQFSLEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFNFKGRVK 585

Human   586 DIGSENDFADDEHSTFEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDC 650
            ||||||||||||||||||||||||||||||||||||.|||||||||||.:|.|||||||||||||
  Rat   586 DIGSENDFADDEHSTFEDNDSRRDSLFVPHRHGERRPSNVSQASRASRGIPTLPMNGKMHSAVDC 650

Human   651 NGVVSLVGGPSTLTS-AGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSIASILTNT 714
            |||||||||||.||| .|||||||||||||||||||||||||||||||| |||||||:|||||||
  Rat   651 NGVVSLVGGPSALTSPVGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDP-SRQRAMSMASILTNT 714

Human   715 MEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAME 779
            ||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||
  Rat   715 MEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAME 779

Human   780 HYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVE 844
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   780 HYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVE 844

Human   845 GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKE 909
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   845 GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKE 909

Human   910 CVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVV 974
            |||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||||
  Rat   910 CVCKISNDCELPRWHMHHFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVV 974

Human   975 LNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRKIREFIQKAFVRKQKALDEI 1039
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   975 LNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRKIREFIQKAFVRKQKALDEI 1039

Human  1040 KPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVT 1104
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1040 KPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVT 1104

Human  1105 VPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEVEPEESLEPEA 1169
            ||||:|||||||||||||||||||||||||||||||||||||||||||||||||.||||||||||
  Rat  1105 VPIALGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEAEPEESLEPEA 1169

Human  1170 CFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQ 1234
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1170 CFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQ 1234

Human  1235 RKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSEL 1299
            |||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||
  Rat  1235 RKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSEL 1299

Human  1300 GAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1364
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1300 GAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1364

Human  1365 HCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMY 1429
            ||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||
  Rat  1365 HCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMY 1429

Human  1430 AAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQ 1494
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1430 AAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQ 1494

Human  1495 KKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEM 1559
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1495 KKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEM 1559

Human  1560 TNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTL 1624
            |||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||
  Rat  1560 TNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTL 1624

Human  1625 FRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREV 1689
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1625 FRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREV 1689

Human  1690 GIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKDHPGSSVKGDCGNPSVGIF 1754
            ||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||
  Rat  1690 GIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGSSVKGDCGNPSVGIF 1754

Human  1755 FFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLS 1819
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|||
  Rat  1755 FFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLS 1819

Human  1820 DFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFM 1884
            |||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat  1820 DFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFM 1884

Human  1885 ASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVSSIYKKDKGKECDGTPIKEDT 1949
            ||||||||||||||||||||||||||:||||||||||||||||||||||||||||.:|||||||.
  Rat  1885 ASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYLLKQKVKKVSSIYKKDKGKEDEGTPIKEDI 1949

Human  1950 LIDKLNENSTPEKTDMTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK 2005
            :.|||||||||||||:||||||||||||||||||||||||||||||||||||||||
  Rat  1950 ITDKLNENSTPEKTDVTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK 2005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456 337/345 (98%)
Ion_trans 150..435 CDD:278921 278/285 (98%)
Na_trans_cytopl 514..630 CDD:288761 106/116 (91%)
II. {ECO:0000305} 741..1013 270/272 (99%)
Ion_trans 776..971 CDD:278921 194/195 (99%)
Na_trans_assoc 997..1203 CDD:284034 204/206 (99%)
III. {ECO:0000305} 1190..1504 312/314 (99%)
Ion_trans 1225..1482 CDD:278921 255/257 (99%)
Na_channel_gate 1474..1526 CDD:240441 52/52 (100%)
IV. {ECO:0000305} 1513..1811 296/298 (99%)
Ion_trans 1548..1786 CDD:278921 236/238 (99%)
GPHH 1798..1853 CDD:293510 53/55 (96%)
Scn2aNP_036779.1 I. {ECO:0000305} 111..456 337/345 (98%)
Ion_trans 150..435 CDD:278921 278/285 (98%)
Na_trans_cytopl 515..630 CDD:288761 106/115 (92%)
II. {ECO:0000305} 741..1013 270/272 (99%)
Ion_trans 776..971 CDD:278921 194/195 (99%)
Na_trans_assoc 997..1203 CDD:284034 204/206 (99%)
III. {ECO:0000305} 1190..1504 312/314 (99%)
Ion_trans 1225..1482 CDD:278921 255/257 (99%)
Na_channel_gate 1474..1526 CDD:240441 52/52 (100%)
IV. {ECO:0000305} 1513..1811 296/298 (99%)
Ion_trans 1548..1786 CDD:278921 236/238 (99%)
GPHH 1798..1853 CDD:293510 53/55 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C370013070
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H75001
Inparanoid 1 1.050 3906 1.000 Inparanoid score I230
OMA 1 1.010
OrthoDB 1 1.010 D10241at32523
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 1 1.000 T2463117
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10037
Phylome 1 0.910 0.800 Consistency score
TreeFam 00.000 Not matched by this tool.
1111.510

Return to query results.
Submit another query.