DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and cca-1

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:NP_001024497.1 Gene:cca-1 / 181045 WormBaseID:WBGene00000367 Length:1885 Species:Caenorhabditis elegans

Alignment Length:1950 Identity:490/1950 (25%)
Similarity:832/1950 (43%) Gaps:486/1950 (25%)


Human   105 ATPALYILTPFNPIRKLAIKILVHSLFNMLIMCTILTNCVFMTMSNP----PDW----------T 155
            |.|||.......|.||.|:::::...|:.:.|..|:.|||.:.|..|    ||.          .
 Worm   106 AEPALRCFYQARPPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDII 170

Human   156 KNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFV---DLG---NVS 214
            .|..:.:   :.||.:|||:|.|| .....::.|.||.|||.:: .|.:.|||   .||   |::
 Worm   171 DNCIFVY---FAFEMVIKIMALGF-YGPAAYMSDTWNRLDFFIV-MAGIAEFVLHEYLGGNINLT 230

Human   215 ALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCL 279
            |:||.||||.|:.::.||.::.:|..|:.::..|.:|::|..|...:|.::|:||:.|.|||:|:
 Worm   231 AIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCV 295

Human   280 QWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDA---LLCGN- 340
            ...|  .:...|.::.|||            |.:..:  ||.:.:...::..|.||   ..|.| 
 Worm   296 INLP--KTISENQSALFNN------------VKLTRF--YIPEDTSLEYICSQPDANGLHTCSNL 344

Human   341 ---SSDAGQCP---EGY----------------ICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQ 383
               :.|..:|.   :.|                .|....|||..|..|||...:|::::|.:::.
 Worm   345 PPYTVDGVKCNLTLDEYDKVTNDSCINWNIYYNECQVMQRNPFQGSVSFDNIGFAWVAIFLVISL 409

Human   384 DFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQ 448
            :.|.::......|......|:|||:|.:|:|::|||.|.|:|..:          ||.|..|.::
 Worm   410 EGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQF----------AETKRRETER 464

Human   449 MLEQLKKQQEE------AQAAAAAASAESRDFSGAGGI----GVFSESSSVASK-----LSSKSE 498
            ||::.|.....      ......|:|.|..|...|..:    ..|..:...|.|     :..::|
 Worm   465 MLQERKMLLNRDSISCTGSEIGGASSKEEGDTVYAAFVRFIGHTFRRTKRAAKKKYTAYMEERAE 529

Human   499 KELKNRRKKKKQK-----------EQSGEEEKNDRVRKSESEDSIRRKGFRFSLEGSRLTYEKRF 552
            ::...|::::|.|           |::.:||....:.:...:|.|.:.|     :|.|:   ||.
 Worm   530 RKSSERQQRRKSKLDDMATLSRIEEKAEDEEDETTITRENGDDQIEQNG-----DGVRI---KRV 586

Human   553 SSPHQSLLSI-RGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHSTFEDNDSRRDSLFVPHR 616
            ....:..:.| .|:...|.....:|                   ||.|   |.|...|.::    
 Worm   587 KIEEEPKIKIGNGNSNGPHYKHSSS-------------------DEES---DEDGEEDQVY---- 625

Human   617 HGERRHSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGPSTLTSAGQLLPEGTTTETEIR 681
                                                                   :|        
 Worm   626 -------------------------------------------------------DG-------- 627

Human   682 KRRSSSYHVSMDLLEDPTSRQRAMSIASILTNTMEELEESRQKCPPCWYKFANMCLIWDCCKPWL 746
                                                 ||:::|..|        ..:|     |.
 Worm   628 -------------------------------------EEAKKKSTP--------SKLW-----WF 642

Human   747 KVKHLVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKII 811
            :.| :...|:.|.|. ..|.:.|::|||.|.:|::...|..:.:|...||.||.:|..||.||||
 Worm   643 REK-IQKFVICDHFT-RGILVAILVNTLSMGVEYHQQPEILTVILEYSNLFFTALFALEMLLKII 705

Human   812 AMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGN 876
            |...:.|..:|:|:|||.||:||::||......||||||:|||||:.||.:..|.|...:.::  
 Worm   706 ASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVLRTFRLLRILKLVRFMPALRYQLVVM-- 768

Human   877 SVGALGNLTL---VLAIIVFIFAVVGMQLFGKSY------------KECV--------------- 911
             :..:.|:|:   :|.:.:|||:::||.|||..:            |:|.               
 Worm   769 -LRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVEEKFLGGLAKKCERKNFDTLLWALITVT 832

Human   912 -------CK----------------ISNDCELPRWHMHDFFHSFLIVFRVLCGE-WIETMWDCME 952
                   ||                ||:.||..|.:..:|..:.:.||::|..| |...:::.|.
 Worm   833 LGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFDNFLFATVTVFQILTQEDWNMVLFNGMA 897

Human   953 VAGQTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSD-------------NLAATDDDNEMNNLQ 1004
            .......| .|:.:|..||.|:.||.:|:|:..|...             ..|..::|.....|:
 Worm   898 QTNPWAAL-YFVALMTFGNYVLFNLLVAILVEGFQESKEEEKRQLEEDARKQAVEEEDERKRELE 961

Human  1005 IAVGR-----MQKGI---------------------------DFVKRK----IREFIQKAFVRKQ 1033
            :.:.:     ...|:                           ...:||    :...|.|..|.:.
 Worm   962 LIIAKTTSPAFNNGVAPAECTCQRPSSPEESPSPRLLSANYHPSPERKHSANLDAIIDKRLVLRN 1026

Human  1034 KALDEIKPLEDLNNKKDSCISNHTT--IEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFI 1096
            .|..:..|:.:  .:.||.::.|.:  :.:...:.|.:....:.||:....              
 Worm  1027 SAPFDRSPVSE--GRDDSRLNRHASLVLPVANGVPYRRQRVHSWSGLCHHF-------------- 1075

Human  1097 NNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEVEP 1161
             ||:..|....|:         .|.::.|..:|.|:|...|.:.              |:...|.
 Worm  1076 -NPNCPVHGRRAL---------IETYAREKFLEASQELKQALAE--------------EEKRNEA 1116

Human  1162 EESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALA 1226
            :::........:.|:.......:.:...|..    ||..|.:..:..||:..::|.|.::...||
 Worm  1117 KQNTFVRKLLKKTCLHNRTEFSLFLMGPKNP----LRIKCLQTTQKKWFDYTVLFFIGINCITLA 1177

Human  1227 FEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQV----YFTNAWCWLDFLIVDVSLV 1287
            .|...|......:..|..:..:||.||..||::|.:|.|..:    ||.:.|..||.::|.:||:
 Worm  1178 MERPSIPPDSFERQFLHISGYIFTVIFTGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLI 1242

Human  1288 SLTANALGYSE----LGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFW 1348
            ::....|...:    .|.|:.||.||||||||.::|..|:::||..|:.::..|.|::|:|..|:
 Worm  1243 NIAFELLATGDSPKIFGVIRVLRLLRALRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFF 1307

Human  1349 LIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYL 1413
            :||.|:||.||.|..||||....|.      |...::|   ||..:. :|.|.:.||||:|...:
 Worm  1308 IIFGILGVQLFKGMMYHCIGPEVGN------VTTKADC---IEDYRN-KWVNHRYNFDNLGQALM 1362

Human  1414 SLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQ 1478
            ||..:::..||:.|||..:|:..|::||....|.:..:||:.|::...||.||:|:||:::||::
 Worm  1363 SLFVLSSKDGWVSIMYQGIDAVGVDVQPIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHK 1427

Human  1479 QKKKFGGQDIFMTEEQKKYYNAMKKLGSK-KPQKPIPRPANKFQGM----------------VFD 1526
            .|:....:   |.|::|:     |:|..| |.||.....|.|.:.|                :..
 Worm  1428 CKEALEKE---MREKEKE-----KRLKRKLKRQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHG 1484

Human  1527 FVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFT 1591
            .||.:.||::|..:|.:|:::|.:|.......:..:|..:|..|..:||.|..:|||:|.:..|.
 Worm  1485 IVTSKYFDLAIAAVIGINVISMAMEFYMMPMGLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFF 1549

Human  1592 I-GWNIFDFVVVILSIVGMFLAEL-IEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALM 1654
            | .||..|..:|||||.|:...|. ..:..::||:.||:|:.||.|:|:|:|.|||||:||..:.
 Worm  1550 IEKWNRLDMFIVILSIAGIIFEEFEALELPINPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVG 1614

Human  1655 MSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREV-------GIDDMFNFETFGNSMICLFQITT 1712
            .:||.:.|:|.|.||:.||:|..|:..|.  |.|.       |:.:..:|:.||.:.:.||:|.|
 Worm  1615 EALPQVGNLGSLFFLLFFIFAALGVELFG--KLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIAT 1677

Human  1713 SAGWDGLLAPILNSGPPDCDPDKDHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILE 1777
            ...|:|::...|..   ||| ..||..::.   |.:|.:...|||.:::||..|:||:.:||:::
 Worm  1678 GDNWNGIMKDALRD---DCD-SSDHCETNC---CVDPILAPCFFVIFVLISQFVLVNVVVAVLMK 1735

Human  1778 NFSVA----TEESAEPL----------SEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPP 1828
            :...:    .|..|||.          |:||     |:.|:.:|.|.:.::..:|.:..:..:.|
 Worm  1736 HLEESNKRDAEGPAEPTGENIENEITKSDDD-----EIVEEHEPLAIEHVKEGELDEEEETEEGP 1795

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456 109/391 (28%)
Ion_trans 150..435 CDD:278921 91/331 (27%)
Na_trans_cytopl 514..630 CDD:288761 19/117 (16%)
II. {ECO:0000305} 741..1013 94/344 (27%)
Ion_trans 776..971 CDD:278921 74/249 (30%)
Na_trans_assoc 997..1203 CDD:284034 33/244 (14%)
III. {ECO:0000305} 1190..1504 106/322 (33%)
Ion_trans 1225..1482 CDD:278921 94/265 (35%)
Na_channel_gate 1474..1526 CDD:240441 15/69 (22%)
IV. {ECO:0000305} 1513..1811 105/337 (31%)
Ion_trans 1548..1786 CDD:278921 85/251 (34%)
GPHH 1798..1853 CDD:293510 6/31 (19%)
cca-1NP_001024497.1 Ion_trans 157..461 CDD:278921 93/335 (28%)
Ion_trans 670..938 CDD:278921 81/272 (30%)
Ion_trans 1176..1430 CDD:278921 94/264 (36%)
Ion_trans 1506..1721 CDD:278921 78/224 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.