DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and egl-19

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:NP_001023079.1 Gene:egl-19 / 177513 WormBaseID:WBGene00001187 Length:1877 Species:Caenorhabditis elegans

Alignment Length:2010 Identity:481/2011 (24%)
Similarity:824/2011 (41%) Gaps:590/2011 (29%)


Human    31 EEKAKRPKQERKD---EDDENGPKPNSDLEAGKSLPFIYGDIPPEMVSVPLEDLDPYYINKKTFI 92
            ||:|...:|||.|   :..:.....:|..:|.|..|                      ..:|.  
 Worm    14 EEQAAADEQERTDLWQQTLQAAVAASSSQDATKKRP----------------------AQRKP-- 54

Human    93 VLNKGKAISRFSATPALYILTPFNPIRKLAIKILVHSLFNMLIMCTILTNCVFMTMSNP-----P 152
             |.:...:.|  :..:|..|:..||||||.|.|:....|..||:..|..||:.:.:..|     .
 Worm    55 -LRQTNVVER--SERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDS 116

Human   153 DWTKN-----VEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLDFTVITFAYVTEF----- 207
            |: ||     :||.|..::|.|.::||:|.||......:||:.||.|||.::....|:..     
 Worm   117 DY-KNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMS 180

Human   208 VDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMG 272
            :...:|.|||.|||||.|:.:|.:|.|:.::.|:::::..|..:.:|.:|.:.::|:|||:||.|
 Worm   181 IQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCG 245

Human   273 NLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALL 337
            .|.:.|:    |.::.::                                        .|.|...
 Worm   246 KLHSTCI----DPATGQL----------------------------------------AQKDPTP 266

Human   338 CGNSSD--AGQCPEGYICVKAG-----------RNPNYGYTSFDTFSWAFLSLFRLMTQDFWENL 389
            ||..::  |.:|.........|           ..||.|.|:||.|..|.|::|:.::.:.|.::
 Worm   267 CGTDTEGSAFKCQPSDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDV 331

Human   390 YQLTLRAAGKTY-MIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQL 453
            ......|.|:.: .|:||.::.||||:::||:|.|::                  .||       
 Worm   332 MYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLS------------------GEF------- 371

Human   454 KKQQEEAQAAAAAASAESRDFSGAGGIGVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSG--- 515
            .|::|:|:|.                 |:|.                 |.|.|::.:::..|   
 Worm   372 SKEREKARAR-----------------GLFQ-----------------KFREKQQLEEDLKGYLD 402

Human   516 ---EEEKNDRVRKSESEDSIRRKGFRFSLEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASL 577
               :.|..:.|.:.|.||                       .|....:                 
 Worm   403 WITQAEDIEPVNEDEQED-----------------------EPVAQTV----------------- 427

Human   578 FSFRGRAKDIGSENDFADDEHSTFEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNG 642
                     :|.|   ||:|                    ||.|..:|..:..|:|         
 Worm   428 ---------VGEE---ADEE--------------------GEERVEDVRPSKWAAR--------- 451

Human   643 KMHSAVDCNGVVSLVGGPSTLTSAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSI 707
                                                                             
 Worm   452 ----------------------------------------------------------------- 451

Human   708 ASILTNTMEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLN 772
                   |:.||:..::|.             ..|:..:|.:....||:          :.::||
 Worm   452 -------MKRLEKLNRRCR-------------RACRRLVKSQTFYWLVI----------LLVLLN 486

Human   773 TLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLME 837
            ||.:..|||..:|......::.||.|..:|:.||.||:.::....|....:|.||.|:|..|::|
 Worm   487 TLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILE 551

Human   838 LGLANVE-----GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAV 897
            ..|...:     |:|||||.||||:||:.|.|.:|..|:..:.||:.::.:|.|:|.:.:.|||:
 Worm   552 FVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFAL 616

Human   898 VGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGE-WIETMWDCME------VAG 955
            :|||:||..:     ..:.....||.:...|..:.|.||::|.|| |...|:..:|      ..|
 Worm   617 LGMQVFGGKF-----NFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLG 676

Human   956 QTMCLTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRK 1020
            ..:|: .::::.:.||.::||:|||:.:     ||||   |.:.:.|.:                
 Worm   677 VIVCI-YYIVLFICGNYILLNVFLAIAV-----DNLA---DADSLTNAE---------------- 716

Human  1021 IREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKY 1085
                       |::...||:                     |:|                     
 Worm   717 -----------KEEEQQEIE---------------------GED--------------------- 728

Human  1086 VVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGA 1150
                                              |||  |...:|.:|  :.....||       
 Worm   729 ----------------------------------EEF--EEGEDEGEE--HGMDEPEG------- 748

Human  1151 PAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIV 1215
              :.|.....|....|..|..|...:.|.....|.....      :.|..|..:|.|::|...::
 Worm   749 --DEEMTSARPRRMSEVPAASTVKPIPKASSLFILSHTN------SFRVFCNMVVNHSYFTNAVL 805

Human  1216 FMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFL 1280
            |.||:||..||.|| .::...|...:|.|.|..||.:|.:|:.||.:.:|. |:...::|...|.
 Worm   806 FCILVSSAMLAAED-PLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGL-VFHKGSFCRNAFN 868

Human  1281 IVDVSL--VSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLV 1343
            ::|:.:  ||||:..|....:..:|.||.||.||||||::|.:|::.||..::.|:.:|.|::||
 Worm   869 LLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLV 933

Human  1344 CLIFWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKA---LIESNQTAR-------W 1398
            ..:...:|:|:||.||.|.|:.|        .|:|.:.. :||:.   ..|.....:       |
 Worm   934 TFMLQFMFAIIGVQLFKGTFFLC--------NDLSKMTE-AECRGEYIHYEDGDPTKPVSKKRVW 989

Human  1399 KNVKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFF 1463
            .|...||||||...:||..|:||:||..::|.|:||...:..|.:.....:.|:|:.|||..:||
 Worm   990 SNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFF 1054

Human  1464 TLNLFIGVIIDNF-NQQKKKFGGQDIFMTEEQKKYYN-AMKKLGSKKPQKPIPRPANKFQGMVFD 1526
            .:|:|:|.:|..| |:.::::  ::..:.:.|:|... |:|   :|..::.|||  |:.|..|:.
 Worm  1055 MMNIFVGFVIVTFQNEGEREY--ENCELDKNQRKCIEFALK---AKPHRRYIPR--NRLQYRVWW 1112

Human  1527 FVTKQVFDISIMILICLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLR-YYYF 1590
            |||.:.|:..|.::|.:|.|::..:....|:...:.|...||:|..:|..|.|||:::|. ..|.
 Worm  1113 FVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYI 1177

Human  1591 TIGWNIFDFVVVILSIVGMFLAELIE--KYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFAL 1653
            :..||:||.:||:.|.:.:...:|..  ...:|...|   ||.|:.|:::|:...:||||||:..
 Worm  1178 SDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFF---RLFRVMRLVKLLSRGEGIRTLLWTF 1239

Human  1654 MMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMF------NFETFGNSMICLFQITT 1712
            |.|..||..:.||:.|:.||||:.||..|.    :|.:||..      ||.:|..:::.||:..|
 Worm  1240 MKSFQALPYVALLIVLLFFIYAVIGMQFFG----KVALDDSTSIHRNNNFHSFPAAILVLFRSAT 1300

Human  1713 SAGWDGLLAPILNSGPPDCDPDKD--HPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVI 1775
            ...|..::....:.....|||..|  |.|...:..||| :....:|:|:.::...:|:|:::|||
 Worm  1301 GEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGN-NFAYPYFISFFMLCSFLVINLFVAVI 1364

Human  1776 LENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAK--PNKV- 1837
            ::||...|.:.: .|.....|.|..:|.::||||...|:...:......:.|||...|  |::: 
 Worm  1365 MDNFDYLTRDWS-ILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLA 1428

Human  1838 --QLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTL 1900
              :|::|::|:.|...:.....|||..:         ..|:|..|.....:|      |.:.:.:
 Worm  1429 CKRLVSMNMPLNSDGTVCFNATLFALVR---------TNLKIYTEGNIDEAN------EQLRSAI 1478

Human  1901 KR------------------KQEEVSAIIIQRAYRRYLLKQKVKKVSSIYKKDKGKECDG 1942
            ||                  |:::|:   :.:.|..:|::...::    :||.|..|..|
 Worm  1479 KRIWKRTHKDLLDEVVPPAGKEDDVT---VGKFYATFLIQDYFRR----FKKRKEMEAKG 1531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456 98/374 (26%)
Ion_trans 150..435 CDD:278921 80/314 (25%)
Na_trans_cytopl 514..630 CDD:288761 16/122 (13%)
II. {ECO:0000305} 741..1013 85/284 (30%)
Ion_trans 776..971 CDD:278921 65/207 (31%)
Na_trans_assoc 997..1203 CDD:284034 23/206 (11%)
III. {ECO:0000305} 1190..1504 105/328 (32%)
Ion_trans 1225..1482 CDD:278921 91/270 (34%)
Na_channel_gate 1474..1526 CDD:240441 13/54 (24%)
IV. {ECO:0000305} 1513..1811 98/309 (32%)
Ion_trans 1548..1786 CDD:278921 76/249 (31%)
GPHH 1798..1853 CDD:293510 16/60 (27%)
egl-19NP_001023079.1 Ion_trans 105..379 CDD:278921 85/344 (25%)
Ion_trans 493..714 CDD:278921 76/235 (32%)
Ion_trans 815..1074 CDD:278921 91/270 (34%)
Ion_trans 1134..1376 CDD:278921 76/250 (30%)
GPHH 1384..1447 CDD:293510 17/63 (27%)
Ca_chan_IQ 1449..1521 CDD:285917 14/94 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.