DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and unc-77

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:NP_001293824.1 Gene:unc-77 / 177379 WormBaseID:WBGene00006809 Length:1867 Species:Caenorhabditis elegans

Alignment Length:2079 Identity:375/2080 (18%)
Similarity:714/2080 (34%) Gaps:687/2080 (33%)


Human   135 IMCTI--LTNCVF----MTMSNPPDW-TKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPW- 191
            |.|||  :|.|:.    :.:..|.:: ....::....|:..:|:::|...|....|.::|.:.| 
 Worm    92 IACTISMITVCIHTPRTIELFQPLNYIILAADFISVSIFMLDSVLRIHYEGIFRCDSSYLSNRWS 156

Human   192 ---------NWLDFTVITFAYVTEFVDL---------GNVSALRTFRVLRALKTISVIPGLKTIV 238
                     :.|.|.:..:..:..|...         |.:.::|.|.::|.:..:......|..:
 Worm   157 QFSVFISIIHLLSFLLHCYQLIDNFFPFLHLNYRAWYGAIRSIRPFIIIRLIPLVVKFKLPKNRI 221

Human   239 GALI-QSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDG 302
            ..|: :|.:::.:|.:..||.::::|:.|:||| |.:...|:|                 ...|.
 Worm   222 EQLLKRSSQQVKNVTLFFVFFMTLYAIFGIQLF-GRMDYHCVQ-----------------PKTDP 268

Human   303 NGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAG-QCPEGYICVKAGRNPN----Y 362
            |..|.        .|..|.|             .:|......| :||...:|::...|..    |
 Worm   269 NNVTI--------MDLAIPD-------------TMCAPEGIGGYECPAPMVCMQLNLNAKGEGFY 312

Human   363 GYTSFDTFSWAFLSLFRLMTQDFWEN-LYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAM 426
            |  .|:.|..:..:::...:::.|.. ||............::|..:||..::.:.|:.:||:..
 Worm   313 G--MFNDFGASVFTVYLAASEEGWVYVLYDCMDSLPSYLAFLYFCTLIFFLAWLVKNVFIAVITE 375

Human   427 AYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGIGVFSESSSVAS 491
            .:.|           ...:|.:|.:                                        
 Worm   376 TFAE-----------IRVQFSEMWQ---------------------------------------- 389

Human   492 KLSSKSEKELKNRRKKKKQKEQSGEEEKNDRVRKSESEDSIRRKGFRFSLEGSRLTYEKRFSSPH 556
                              :||.:.:|                  |||..||.:            
 Worm   390 ------------------KKEVTLDE------------------GFRKKLEKT------------ 406

Human   557 QSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHSTFEDNDSRRDSLFVPHRHGERR 621
                                                  ||                         
 Worm   407 --------------------------------------DD------------------------- 408

Human   622 HSNVSQASRASRVLPILPMNGKMHSAVDCNGVVSLVGGPSTLTSAGQLLPEGTTTETEIRKRRSS 686
                                                 |...:...|::.|||             
 Worm   409 -------------------------------------GWRLIRLDGEVEPEG------------- 423

Human   687 SYHVSMDLLEDPTSRQRAMSIASILTNTMEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHL 751
                                                                     |..|::.:
 Worm   424 ---------------------------------------------------------PKQKLQWM 431

Human   752 VNLVVMDPFVDLAITICIVLNTLFMAMEHY-------PMTEQFSSVLSVGNLVFTGIFTAEMFLK 809
            :..:....||    .|.:|:|.:..||..|       |....| .:..||   ||.:|..|..:|
 Worm   432 LRSMYFQCFV----IIFVVINAIGNAMFVYRHDETDKPRKYNF-YLFEVG---FTILFNVECIIK 488

Human   810 IIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVEGLSVLR------------SFRLLRVFKLAK 862
            |:......:.:.|  ||.        .||.|.....|:.::            :|||||   |.|
 Worm   489 ILCYGFRNFIRRG--IFK--------FELILCLGSSLNCVKFFYERNYFTYFQTFRLLR---LIK 540

Human   863 SWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKISNDCELPR-WHMH 926
            :.|.|...:..|.:....||.|.:.....:..::.:.:|||              ..:|. .|..
 Worm   541 ASPILEDFVWKIFSPGKKLGGLVIFTIAFICCYSAISLQLF--------------YSVPNLHHFR 591

Human   927 DFFHSFLIVFRVLCGE-WIETMWDCMEVAGQTMCLTV---FMMVMVIGNLVVLNLFLALLLSSFS 987
            .|..:|:.:|:::..| |.:.:.:.:......:...|   |:...:...|:||:||:|::|    
 Worm   592 TFPQAFMSMFQIITQEGWTDFVVEVLRATDDNLVPLVALYFVAYHLFVTLIVLSLFVAVIL---- 652

Human   988 SDNLAATDDDNEMNNLQI--AVGRMQKGIDFVKRKIREF---IQKAFVRK--------------- 1032
             |||...::..::..|:.  |...|:..:.:..|...:|   .|.|.:||               
 Worm   653 -DNLEMDEELKKVKQLRAREATTSMRSTLPWRLRVFEKFPTRPQMAAMRKADSDFPMPKVRGSFT 716

Human  1033 -QKALDEIKPLEDL--------------NNKKDSCISNHTTIEIGKDL------NYLKDGNGTTS 1076
             |.|:|......|:              ..|:....|..|..:||...      |.|:..:.|..
 Worm   717 HQFAVDHSLETTDVIESDFEFPKRIMKSAGKRKISKSGLTFRQIGSTSLRCSLNNLLEMSDRTRQ 781

Human  1077 GIGSSVEKYVVDESDYMSFINNPSLTVTVPIAVGESD----------------FENLNTEEFSSE 1125
            .:.:|           :||:  |..|.:........|                ..|.....:|..
 Worm   782 SLSNS-----------LSFL--PHFTRSSGSLYPRKDALPKSRSMTGKFLQTAVRNKQFNMYSEN 833

Human  1126 SDMEESKEKLNATSSSEGSTVDIGA------PAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQI 1184
            .|:....:.....::.:|. :||.|      .||..:..:| |:..|....|........:..| 
 Worm   834 GDLSRPSDSAPKKNAKQGE-IDIRALQQKRQLAEITRNRIE-EDMRENHPFFDRPLFLVGRASQ- 895

Human  1185 SIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTM--LEYADK 1247
                        ||:.|.|:| |:.:::    ....::|....:..:.|.|..|..|  :::|..
 Worm   896 ------------LREFCKKMV-HSKYDS----QDDGTNGGAKTKKRFKEIRALIGIMPYIDWAMA 943

Human  1248 VFTYIFILEMLLK--WVAYGFQVYFTNAWCWLD--FLIVDVSL---VSLTANALGYS------EL 1299
            ..|.:..:.||.:  |...|..:...|.:..:.  |.::.::.   |.:.||.|.::      ::
 Worm   944 TVTIVSCISMLFESPWPTTGENLVMNNGYLQISDYFFVLSMTFELCVKIIANGLFFTPKAVVRDV 1008

Human  1300 GAIKS--------------------------LRTLRALRPLRALSRFEGMRVVVNALLGAIPSIM 1338
            |.:.:                          |...||:||||..:....:|.||.........|:
 Worm  1009 GGVMNLFIYFTSVIFLAWMPKHVEINSLAQFLMICRAMRPLRIYTLVPHIRRVVLEFFRGFKEIL 1073

Human  1339 NVLLVCLIFWLIFSIMGVNLFAGKFYHCINYT-------TGEMFDVSVVNNY----SECKALIES 1392
            .|.::.::...||:..||.:..||...|.:.|       ||..:....|...    .:.:|:...
 Worm  1074 LVTILMIVVMFIFASFGVQIVGGKLAACNDPTVSSRENCTGVFWQKLFVTRLEVYGKDTEAMHPK 1138

Human  1393 NQTAR-WKNVK-VNFDNVGLGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEDNLYMYLY 1452
            ....| |.|.: .|||:||...|:|.:..:||||   .||::    ||:         ..:..::
 Worm  1139 IMVPRVWTNPRNFNFDHVGNAMLALFETLSFKGWNVIRDILW----SRH---------GPWAVVF 1190

Human  1453 FVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPA 1517
            ..|::..|....|.||:||:|.|:.|.:     ....:|.:|:::::...:|...:|....|:|:
 Worm  1191 IHIYVFIGCMIGLTLFVGVVIANYTQNR-----GTALLTVDQRRWHDLKARLKMAQPLHVPPKPS 1250

Human  1518 N--KFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQE--------MTNILYWINLVFIV 1572
            .  :.:..::|....:.|:.:..:|:.||..|:::..:.:.:|        :|.:..::|::|::
 Worm  1251 ESARLRTKLYDLTMSRWFNQAFALLVVLNSFTLVIPWNVEEEEQRATYVFTVTALAAFMNMLFVI 1315

Human  1573 LFTGECVLKLISLRYYYFTIGW----NIFDFVVVILSIVGMFLAELIEKYFVSPTLFRV-----I 1628
                |.:||:|:   |.|:..|    |..|.::.:..::.:||     .:||:....::     :
 Worm  1316 ----EIILKVIA---YTFSGFWQSRRNRVDLLITVFGVIWIFL-----HFFVALPSSKIDVDVQV 1368

Human  1629 RLAR----------IGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFA 1683
            .|.:          |.|...:......::.|:..::||:...|.|...|||::..||..|:..|.
 Worm  1369 ELKKFTYTFGYLVVILRFFTIASRNSTLKMLMLTVIMSMFRSFFIITALFLLVLFYAYTGVILFP 1433

Human  1684 YVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKDHPGSSV-KGDCG 1747
            .||..:.:....||.|...:::.||:..|...|:.::...:.|. |.|..::   |.:. :.|||
 Worm  1434 MVKYGMAVSKHVNFRTASEALVVLFRCLTGEDWNDIMHDCMRSA-PFCYWNE---GMNYWETDCG 1494

Human  1748 NPSVGIFFFVSYIIISFLVVVNMYIAVILENFSV--ATEESAEPLSEDDFEMFYEVWEKFDPDAT 1810
            |....|.:|.|:.:|...:|.|:.:|||:||||:  ::||.| .||..|...|..||...|.:..
 Worm  1495 NFYGAIIYFCSFYLIITYIVRNLLVAVIMENFSLFYSSEEDA-LLSYADIRNFQYVWNMVDQEQK 1558

Human  1811 QFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDL-----PMVSGDRIHCLDILFAFTKRVLGESG 1870
            :.|...::. |...|....|...|.|.:::...:     .:.:|:.:...|:|:..:.|      
 Worm  1559 RTIPVERVK-FLLRLLKGRLEVDPEKDRILFKHMCYEMERLHNGEEVSFHDVLYMLSYR------ 1616

Human  1871 EMDALR-IQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYR---RYLLKQKVKKVSSI 1931
            .:|..: :|:||..                   ::||:..||.:...:   |..|:..::|:.:.
 Worm  1617 SVDIRKSLQLEELL-------------------QREELEFIIEEEVAKQTIRTWLEGCLRKMRNP 1662

Human  1932 YKKDK------GKECDGTPI----------KEDTLIDKL------NENSTPEKTDMTPSTTSPP 1973
            .:||.      |   .|.|:          .|:|:..:|      .::...|:|:.:...|.||
 Worm  1663 SQKDAEGVLPFG---GGHPVIHSSGHSSISHEETVAQRLRFENIRGDSVDTEETESSEEETPPP 1723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456 63/354 (18%)
Ion_trans 150..435 CDD:278921 55/312 (18%)
Na_trans_cytopl 514..630 CDD:288761 8/116 (7%)
II. {ECO:0000305} 741..1013 65/298 (22%)
Ion_trans 776..971 CDD:278921 45/219 (21%)
Na_trans_assoc 997..1203 CDD:284034 44/269 (16%)
III. {ECO:0000305} 1190..1504 78/371 (21%)
Ion_trans 1225..1482 CDD:278921 69/314 (22%)
Na_channel_gate 1474..1526 CDD:240441 8/54 (15%)
IV. {ECO:0000305} 1513..1811 80/330 (24%)
Ion_trans 1548..1786 CDD:278921 64/268 (24%)
GPHH 1798..1853 CDD:293510 11/60 (18%)
unc-77NP_001293824.1 Ion_trans 107..383 CDD:278921 55/328 (17%)
Ion_trans 455..660 CDD:278921 53/241 (22%)
Ion_trans 973..1214 CDD:278921 57/254 (22%)
Ion_trans 1310..1534 CDD:278921 61/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.