DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and F17C8.6

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:NP_497974.1 Gene:F17C8.6 / 175626 WormBaseID:WBGene00008911 Length:279 Species:Caenorhabditis elegans

Alignment Length:254 Identity:51/255 (20%)
Similarity:85/255 (33%) Gaps:82/255 (32%)


Human  1776 LENFSV--ATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQ 1838
            :||||:  ::||.| .||..|...|..||...|.:..:.|...::.                   
 Worm     1 MENFSLLYSSEEDA-LLSYADIRNFQLVWNMVDIEQKRSIPVRRVK------------------- 45

Human  1839 LIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDAL--RIQMEERFMASNPSKVSYEPITTTLK 1901
                              .|....|..|..:.|.|.|  :....|.....|...||:..:...|.
 Worm    46 ------------------FLLRLLKGRLEVNDESDGLLFKHMCHEMERLHNGDDVSFHDVLNMLS 92

Human  1902 RKQEEVSAI-----IIQRAYRRYLLKQKVKK------VSSIYKKDKGKECDGTPIKEDTLIDKLN 1955
            .:..::...     ::||....|:::::|.|      :.:..|..|.|                 
 Worm    93 YRSVDIRKSLQLEELLQREELEYIIEEEVAKHTIRAWLENCLKNIKAK----------------- 140

Human  1956 ENSTPEKTDMTPSTTS-PPSYDSVTK--------PEKEKFEKDK---SEKEDKGKDIRE 2002
            :|:|..|.....||.: |.|.:.:||        ||::..:.||   .:|..:|..|.|
 Worm   141 QNNTLGKMSSIGSTFAFPQSQEVLTKGVVLTEASPEEDSLQGDKGSGKKKAQRGNSITE 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456
Ion_trans 150..435 CDD:278921
Na_trans_cytopl 514..630 CDD:288761
II. {ECO:0000305} 741..1013
Ion_trans 776..971 CDD:278921
Na_trans_assoc 997..1203 CDD:284034
III. {ECO:0000305} 1190..1504
Ion_trans 1225..1482 CDD:278921
Na_channel_gate 1474..1526 CDD:240441
IV. {ECO:0000305} 1513..1811 14/37 (38%)
Ion_trans 1548..1786 CDD:278921 6/12 (50%)
GPHH 1798..1853 CDD:293510 5/55 (9%)
F17C8.6NP_497974.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.