DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and Scn2a

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:NP_001092768.1 Gene:Scn2a / 110876 MGIID:98248 Length:2006 Species:Mus musculus

Alignment Length:2006 Identity:1966/2007 (98%)
Similarity:1986/2007 (99%) Gaps:1/2007 (0%)


Human     1 MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSLPFI 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSLPFI 65

Human    66 YGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRKLAIKILVHSL 130
            ||||||||||.||||||||||||||||||||||||||||||.|||||||||||||||||||||||
Mouse    66 YGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATSALYILTPFNPIRKLAIKILVHSL 130

Human   131 FNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLD 195
            ||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   131 FNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLD 195

Human   196 FTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLS 260
            |||||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   196 FTVITFAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLS 260

Human   261 VFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSH 325
            ||||||||||||||||||||||||||:||||||||||||||.|||.||||:::||||||||||||
Mouse   261 VFALIGLQLFMGNLRNKCLQWPPDNSTFEINITSFFNNSLDWNGTAFNRTMNMFNWDEYIEDKSH 325

Human   326 FYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLY 390
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   326 FYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLY 390

Human   391 QLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKK 455
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   391 QLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKK 455

Human   456 QQEEAQAAAAAASAESRDFSGAGGIGVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKN 520
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||.
Mouse   456 QQEEAQAAAAAASAESRDFSGAGGIGVFSESSSVASKLSSKSEKELKNRRKKKKQKEQAGEEEKE 520

Human   521 DRVRKSESEDSIRRKGFRFSLEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAK 585
            |.||||.||||||:||||||||||||||||||||||||||||||||||||||||||||||:||.|
Mouse   521 DAVRKSASEDSIRKKGFRFSLEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFKGRVK 585

Human   586 DIGSENDFADDEHSTFEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAVDC 650
            ||||||||||||||||||||||||||||||||||||.|||||||||||.:|.|||||||||||||
Mouse   586 DIGSENDFADDEHSTFEDNDSRRDSLFVPHRHGERRPSNVSQASRASRGIPTLPMNGKMHSAVDC 650

Human   651 NGVVSLVGGPSTLTS-AGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSIASILTNT 714
            |||||||||||.||| .||||||||||||||||||||||||||||||||||||||||:|||||||
Mouse   651 NGVVSLVGGPSALTSPVGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTSRQRAMSMASILTNT 715

Human   715 MEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAME 779
            ||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||
Mouse   716 MEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAME 780

Human   780 HYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVE 844
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   781 HYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVSLSLMELGLANVE 845

Human   845 GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKE 909
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   846 GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKE 910

Human   910 CVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVV 974
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   911 CVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVV 975

Human   975 LNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRKIREFIQKAFVRKQKALDEI 1039
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   976 LNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRKIREFIQKAFVRKQKALDEI 1040

Human  1040 KPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVT 1104
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1041 KPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESDYMSFINNPSLTVT 1105

Human  1105 VPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEVEPEESLEPEA 1169
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||.||||||||||
Mouse  1106 VPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAPAEGEQPEAEPEESLEPEA 1170

Human  1170 CFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQ 1234
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1171 CFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQ 1235

Human  1235 RKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSEL 1299
            |||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||
Mouse  1236 RKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQMYFTNAWCWLDFLIVDVSLVSLTANALGYSEL 1300

Human  1300 GAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1364
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1301 GAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFY 1365

Human  1365 HCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMY 1429
            ||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||
Mouse  1366 HCINYTTGEMFDVSVVNNYSECQALIESNQTARWKNVKVNFDNVGLGYLSLLQVATFKGWMDIMY 1430

Human  1430 AAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQ 1494
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1431 AAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQ 1495

Human  1495 KKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEM 1559
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1496 KKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEM 1560

Human  1560 TNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTL 1624
            |||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||
Mouse  1561 TNILYWINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTL 1625

Human  1625 FRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREV 1689
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1626 FRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREV 1690

Human  1690 GIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKDHPGSSVKGDCGNPSVGIF 1754
            ||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||
Mouse  1691 GIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPGSSVKGDCGNPSVGIF 1755

Human  1755 FFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAKLS 1819
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|||
Mouse  1756 FFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFCKLS 1820

Human  1820 DFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFM 1884
            |||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1821 DFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFM 1885

Human  1885 ASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVSSIYKKDKGKECDGTPIKEDT 1949
            ||||||||||||||||||||||||||:||||||||||||||||||||||||||||.:|||||||.
Mouse  1886 ASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRYLLKQKVKKVSSIYKKDKGKEDEGTPIKEDI 1950

Human  1950 LIDKLNENSTPEKTDMTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK 2005
            :.|||||||||||||:||||||||||||||||||||||||||||||||||||||||
Mouse  1951 ITDKLNENSTPEKTDVTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDKGKDIRESKK 2006

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456 337/345 (98%)
Ion_trans 150..435 CDD:278921 278/285 (98%)
Na_trans_cytopl 514..630 CDD:288761 108/116 (93%)
II. {ECO:0000305} 741..1013 271/272 (100%)
Ion_trans 776..971 CDD:278921 195/195 (100%)
Na_trans_assoc 997..1203 CDD:284034 205/206 (100%)
III. {ECO:0000305} 1190..1504 312/314 (99%)
Ion_trans 1225..1482 CDD:278921 255/257 (99%)
Na_channel_gate 1474..1526 CDD:240441 52/52 (100%)
IV. {ECO:0000305} 1513..1811 296/298 (99%)
Ion_trans 1548..1786 CDD:278921 236/238 (99%)
GPHH 1798..1853 CDD:293510 53/55 (96%)
Scn2aNP_001092768.1 I. {ECO:0000250|UniProtKB:P04775} 111..456 337/345 (98%)
Ion_trans 128..435 CDD:334124 299/307 (97%)
Na_trans_cytopl 516..700 CDD:338179 171/184 (93%)
II. {ECO:0000250|UniProtKB:P04775} 742..1014 271/272 (100%)
Ion_trans 759..972 CDD:334124 213/213 (100%)
Na_trans_assoc 998..1204 CDD:336429 205/206 (100%)
III. {ECO:0000250|UniProtKB:P04775} 1191..1505 312/314 (99%)
Ion_trans 1208..1483 CDD:334124 273/275 (99%)
Na_channel_gate 1475..1527 CDD:240441 52/52 (100%)
IV. {ECO:0000250|UniProtKB:P04775} 1514..1812 296/298 (99%)
Ion_trans 1532..1787 CDD:334124 253/255 (99%)
GPHH 1791..1854 CDD:339854 61/63 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C370013751
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H75001
Inparanoid 1 1.050 3923 1.000 Inparanoid score I278
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D37221at33208
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 1 1.000 T2446743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10037
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9280
TreeFam 00.000 Not matched by this tool.
1212.540

Return to query results.
Submit another query.