DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN2A and scn1a

DIOPT Version :8

Sequence 1:NP_001035232.1 Gene:SCN2A / 6326 HGNCID:10588 Length:2005 Species:Homo sapiens
Sequence 2:XP_012826731.1 Gene:scn1a / 100488621 XenbaseID:XB-GENE-978019 Length:2020 Species:Xenopus tropicalis

Alignment Length:2024 Identity:1703/2025 (84%)
Similarity:1849/2025 (91%) Gaps:23/2025 (1%)


Human     1 MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGKSLPFI 65
            |||:.||||||||||:|:||||.|||:||||||||:||||.:|:||:|||||:||||||||||||
 Frog     1 MAQARLVPPGPDSFRYFSRESLEAIEKRIAEEKAKKPKQEHRDDDDDNGPKPSSDLEAGKSLPFI 65

Human    66 YGDIPPEMVSVPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRKLAIKILVHSL 130
            ||||||.|||.|||||||||:|:|||||||:||||.|||||.||||||||||:||:|||:|||||
 Frog    66 YGDIPPGMVSEPLEDLDPYYMNQKTFIVLNRGKAIFRFSATSALYILTPFNPLRKVAIKVLVHSL 130

Human   131 FNMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFCLEDFTFLRDPWNWLD 195
            |:||||||||||||||||||||:|||||||||||||||||||||||||||||.||||||||||||
 Frog   131 FSMLIMCTILTNCVFMTMSNPPEWTKNVEYTFTGIYTFESLIKILARGFCLEKFTFLRDPWNWLD 195

Human   196 FTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLS 260
            |:||..|||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   196 FSVIVMAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLS 260

Human   261 VFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSH 325
            ||||||||||||:||||||||||.:.....||....|.:::.:....|.|.|.|:|:|||.||:|
 Frog   261 VFALIGLQLFMGHLRNKCLQWPPIDYFPLTNIPPILNGTMNIHDPFGNTTNSTFDWEEYITDKNH 325

Human   326 FYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLY 390
            ||.||||.|.||||||||:||||:||||||.|:||||||||||||||||||||||||||:|||||
 Frog   326 FYKLEGQKDFLLCGNSSDSGQCPKGYICVKTGKNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLY 390

Human   391 QLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKK 455
            ||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||
 Frog   391 QLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKK 455

Human   456 QQEEAQAAAAAASAESRDFSGAGGIGVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKN 520
            |||||||||.||...||::|..||.|..|||||.||||||||.|:.:||:||:||||...|.||.
 Frog   456 QQEEAQAAAVAALNMSREYSEDGGFGPLSESSSEASKLSSKSAKDRRNRKKKRKQKELGEEYEKG 520

Human   521 D--RVRKSESEDSIRRKGFRFSLEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGR 583
            |  :..|||||.||:|||||||:||:|||||.:||||||||||||||||||||||||||||||.|
 Frog   521 DDEKFPKSESETSIKRKGFRFSIEGNRLTYENKFSSPHQSLLSIRGSLFSPRRNSRASLFSFRNR 585

Human   584 AKDIGSENDFADDEHSTFEDNDSRRDSLFVPHRHGERRHSNVSQASRASRVLPILPMNGKMHSAV 648
            |||:|||||||||||||||||:|||.|||||:||||||:||:||.|::|:.:.:||.||||||.|
 Frog   586 AKDVGSENDFADDEHSTFEDNESRRGSLFVPNRHGERRNSNISQVSKSSKTMTVLPANGKMHSTV 650

Human   649 DCNGVVSLVGGPSTLTS-AGQLLPE-----------GTTTETEIRKRRSSSYHVSMDLLEDPTSR 701
            ||||||||:||||..|| .|.||||           |||||||||||:||.|.|.||||||||:|
 Frog   651 DCNGVVSLLGGPSVPTSPVGLLLPEVIVDKPASDDNGTTTETEIRKRKSSCYQVPMDLLEDPTAR 715

Human   702 QRAMSIASILTNTMEELEESRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAIT 766
            |||:|:|||||||:|||||||||||||||||||..||||||:.||.|||:|.|:|||||||||||
 Frog   716 QRALSVASILTNTVEELEESRQKCPPCWYKFANTFLIWDCCENWLTVKHIVKLIVMDPFVDLAIT 780

Human   767 ICIVLNTLFMAMEHYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIV 831
            ||||||||||||||||||::|:.|||:|||||||||||||..|:||:|||||||||||||||.||
 Frog   781 ICIVLNTLFMAMEHYPMTKEFNDVLSIGNLVFTGIFTAEMVFKLIALDPYYYFQEGWNIFDGIIV 845

Human   832 SLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFA 896
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   846 SLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFA 910

Human   897 VVGMQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLT 961
            ||||||||||||||||||:.:||||||||:||||||||||||||||||||||||||||||:|||.
 Frog   911 VVGMQLFGKSYKECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLL 975

Human   962 VFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDFVKRKIREFIQ 1026
            |||:||||||||||||||||||||||||||.|||||||||||||||||:|:|||:||:.|||.||
 Frog   976 VFMLVMVIGNLVVLNLFLALLLSSFSSDNLTATDDDNEMNNLQIAVGRIQRGIDYVKKTIRECIQ 1040

Human  1027 KAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIGSSVEKYVVDESD 1091
            ||||:|||.||||||||:|:||::||:.||..:||.|.|:|.|..||||||:|||||||::||:|
 Frog  1041 KAFVKKQKGLDEIKPLEELHNKRESCLFNHNAVEINKVLDYHKGDNGTTSGVGSSVEKYIIDEND 1105

Human  1092 YMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATSSSEGSTVDIGAP----- 1151
            |||||:|||||||||||||||||||||||:||||||:||||||||.|||||||||||..|     
 Frog  1106 YMSFIHNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLNMTSSSEGSTVDIRPPGVVAE 1170

Human  1152 AEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRKTCYKIVEHNWFETFIVF 1216
            .|||..::|.||:|||:|||||.||::|..|.::|||.||||||..|||||.|||||||||||:|
 Frog  1171 GEGEPIDIESEEALEPDACFTEGCVKRFPICYVNIEENKGKLWWTFRKTCYTIVEHNWFETFIIF 1235

Human  1217 MILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQVYFTNAWCWLDFLI 1281
            ||||||||||||||||||||||||||||||||||||||||||||||||||..|||||||||||||
 Frog  1236 MILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFLI 1300

Human  1282 VDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLI 1346
            ||||||||.||||||||||||||||||||||||||||||||||||||||:|||||||||||||||
 Frog  1301 VDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSIMNVLLVCLI 1365

Human  1347 FWLIFSIMGVNLFAGKFYHCINYTTGEMFDVSVVNNYSECKALIESNQTARWKNVKVNFDNVGLG 1411
            ||||||||||||||||:|||:|.|||||...:.|||.|:|   :..|::||||||||||||||.|
 Frog  1366 FWLIFSIMGVNLFAGKYYHCVNTTTGEMLLDTQVNNRSDC---LHLNESARWKNVKVNFDNVGAG 1427

Human  1412 YLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNF 1476
            ||:|||||||||||||||||||||.||.||:||||||||||||||||||||||||||||||||||
 Frog  1428 YLALLQVATFKGWMDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNF 1492

Human  1477 NQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILI 1541
            ||||||||||||||||||||||||||||||||||||||||.||:||:||||||||.|||.|||||
 Frog  1493 NQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPPNKYQGLVFDFVTKQAFDIIIMILI 1557

Human  1542 CLNMVTMMVETDDQSQEMTNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSI 1606
            ||||||||:|||:|||:|.|.|||||||||:||||||:||:||||:|||||||||||||||||||
 Frog  1558 CLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWNIFDFVVVILSI 1622

Human  1607 VGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVM 1671
            ||||||::|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog  1623 VGMFLADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVM 1687

Human  1672 FIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPDKD 1736
            |||||||||||||||:|.||||||||||||||||||||||||||||||||||||||.|||||..:
 Frog  1688 FIYAIFGMSNFAYVKKESGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGAPDCDPQME 1752

Human  1737 HPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEV 1801
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||.||||||||||
 Frog  1753 HPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLGEDDFEMFYEV 1817

Human  1802 WEKFDPDATQFIEFAKLSDFADALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVL 1866
            |||||||||||||::|||:|||||||||.|||||:||||||||||||||||||||||||||||||
 Frog  1818 WEKFDPDATQFIEYSKLSNFADALDPPLRIAKPNRVQLIAMDLPMVSGDRIHCLDILFAFTKRVL 1882

Human  1867 GESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIIIQRAYRRYLLKQKVKKVSSI 1931
            ||..||||||:.||||||||||||.||||||:||:|||||:|.:||||.:|:|||::.:||.|.:
 Frog  1883 GEGDEMDALRLPMEERFMASNPSKASYEPITSTLRRKQEELSVVIIQRCFRKYLLRKTIKKASYL 1947

Human  1932 YKKDKGKECDGTPIKEDTLIDKLNENSTPEKTDMTPSTTSPPSYDSVTKPEKEKFEKDKSEKEDK 1996
            |||:| ...:..|||||.:|||||.|||.|||||||||||||||||||||||||.||||:|||:|
 Frog  1948 YKKEK-LGVNSLPIKEDMVIDKLNGNSTTEKTDMTPSTTSPPSYDSVTKPEKEKHEKDKAEKENK 2011

Human  1997 GKDIRESKK 2005
            .||.||:||
 Frog  2012 SKDARENKK 2020

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN2ANP_001035232.1 I. {ECO:0000305} 111..456 297/345 (86%)
Ion_trans 150..435 CDD:278921 241/285 (85%)
Na_trans_cytopl 514..630 CDD:288761 95/118 (81%)
II. {ECO:0000305} 741..1013 246/272 (90%)
Ion_trans 776..971 CDD:278921 178/195 (91%)
Na_trans_assoc 997..1203 CDD:284034 154/211 (73%)
III. {ECO:0000305} 1190..1504 283/314 (90%)
Ion_trans 1225..1482 CDD:278921 230/257 (89%)
Na_channel_gate 1474..1526 CDD:240441 49/52 (94%)
IV. {ECO:0000305} 1513..1811 275/298 (92%)
Ion_trans 1548..1786 CDD:278921 221/238 (93%)
GPHH 1798..1853 CDD:293510 50/55 (91%)
scn1aXP_012826731.1 Ion_trans 150..435 CDD:278921 241/285 (85%)
Na_trans_cytopl 512..631 CDD:288761 95/119 (80%)
Ion_trans 790..985 CDD:278921 178/195 (91%)
Na_trans_assoc 1011..1222 CDD:284034 154/211 (73%)
Ion_trans 1244..1498 CDD:278921 230/257 (89%)
Na_channel_gate 1490..1542 CDD:240441 49/52 (94%)
Ion_trans 1564..1802 CDD:278921 221/238 (93%)
GPHH 1814..1869 CDD:293510 50/55 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D10241at32523
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.