DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and CCH1

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:NP_011733.3 Gene:CCH1 / 853131 SGDID:S000003449 Length:2039 Species:Saccharomyces cerevisiae

Alignment Length:2158 Identity:404/2159 (19%)
Similarity:706/2159 (33%) Gaps:809/2159 (37%)


Human    13 SFNFFTRESLAAIERRIAEEKAKNPKP------------DKKDD------------DENG----- 48
            ||:.::|.|    .||::...:...:|            |..||            ||.|     
Yeast   146 SFSSYSRSS----SRRVSNSPSSTDRPPRSAKVLSLIAADDMDDFEDLQKGFKSAIDEEGLTWLP 206

Human    49 ------PKPNSDL--EAG----KNLPFIY----------GDI--PPE-----MVSEPLE------ 78
                  .:|.||:  :.|    :::|.::          |.|  .||     .|||.||      
Yeast   207 QLKSEKSRPVSDVGEDRGEGEQESIPDVHTPNVGASATPGSIHLTPEPAQNGSVSEGLEGSINNS 271

Human    79 ----------DLDPYYINKKTFIVLNKGKAIFRF--------SATSALY-----ILTPFNPLR-K 119
                      .|.|...:|....|:...:.|..|        |....||     :.:|.|||| |
Yeast   272 RKKPSPKFFHHLSPQKEDKDQTEVIEYAEDILDFETLQRKLESRPFVLYGHSLGVFSPTNPLRIK 336

Human   120 IAIKILVHSLFSML---------IMCTILT----NCVFM-TMSNPPDWTKNVEYTFTGIYTFESL 170
            || :.|:|..:|:|         |:..|.|    |.||: ..||   ||....:..:..:|...:
Yeast   337 IA-RFLLHRRYSLLYNTLLTFYAILLAIRTYNPHNVVFLYRFSN---WTDYFIFILSACFTGNDI 397

Human   171 IKIIARGFC------------------------------------LEDF---------------- 183
            .||||.||.                                    |.||                
Yeast   398 AKIIAFGFWDDSEMFKAYGREYKSILQRSGIMKLYIYLREKYGRKLIDFIIPFRIISPGEETKYQ 462

Human   184 -------------------------TFLRDPWNWLDFTVITFAYVTEFVDLGNV---SALRTFR- 219
                                     .|.|..||.:|.......::..|:.:.:.   :.:|.|: 
Yeast   463 RSSLSTSLTKPYGAKENQRPFGTPRAFARSSWNRIDLVSSVSFWLGMFLSIKSYDTKTGIRIFKP 527

Human   220 --VLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCIQWPP 282
              :||.|:.::|..|:.:|:..|...:.:|.:|..:.|:....|.::|:|:|.|:.|.:|:.:.|
Yeast   528 LAILRILRLVNVDTGMPSILRGLKYGIPQLVNVSSMLVYFWIFFGILGVQIFQGSFRRQCVWFNP 592

Human   283 TNASLEEHSIEKNITVNYNGTLINETVFEFDWKSYIQDSRYHYFLEGFLDALLC----------- 336
            .:.:                     ..:::|.:          |..|:||.:..           
Yeast   593 EDPT---------------------DTYQYDMQ----------FCGGYLDPVTKRKQNYIYEDGS 626

Human   337 -GNSSDAGQCPEGYMCVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYM 400
             |:.|....||:...|| :..||..|..|||....:...:|.:|:.:.:.:|...|:.:......
Yeast   627 EGSVSKGFLCPQYSKCV-SNANPYNGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDSDEMAAC 690

Human   401 IFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMIEQLKKQQEAAQQAATAT 465
            :||::.||:.:.:|:||::||:..::|..|:      |.|:.:|                     
Yeast   691 LFFIVCIFVLTIWLLNLLIAVLVSSFEIANE------EYKKKKF--------------------- 728

Human   466 ASEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFQKSESEDSIR 530
                                                                             
Yeast   729 ----------------------------------------------------------------- 728

Human   531 RKGFRFSIEGNRLT-YEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDE 594
                   |.|:|.| |..|..:.:.....::.:                                
Yeast   729 -------IYGSRKTGYVARIVTGYWKYFKLKAN-------------------------------- 754

Human   595 HSTFEDNESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGGPSV 659
                                 :.:..|.||     :.||::       |.|:...|:.::     
Yeast   755 ---------------------QTKFPNWSQ-----KGLAIY-------SHVEFIFVILII----- 781

Human   660 PTSPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILTNTV 724
                                     .:..||                          ||:..:|.
Yeast   782 -------------------------CDIGMR--------------------------ASVKVSTS 795

Human   725 EELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEH 789
            .                       :|:...||....:::|:   |::....:.:.|..::     
Yeast   796 A-----------------------NCNNILLKTDRGISIVL---FIESLARLVLYLPNMW----- 829

Human   790 YPMTDHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLVELGLANVEG 854
                                        |.:....|.|         .||:::..:.:....|||
Yeast   830 ----------------------------KFLTKPSYVY---------DFIISIITLVISCLAVEG 857

Human   855 --------LSVL---RSFRLLRVFKLAKS-WPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV 907
                    ||:.   |.:|::..|.|.|. |.      :|:.|.| .:.||:.......|:.|::
Yeast   858 VLGHMYAWLSIFHISRFYRVIISFNLTKKLWK------QILSNGV-MIWNLSSFYFFFTFLVAII 915

Human   908 GMQLFGKSYKDCVCKIASDCQLPRWHMND-------FFHSFLIVFRVLCGE-WIETMWDCME--- 961
            ....|             :..:|...|.|       ..:|||.:|.:...| |.:.::...:   
Yeast   916 MAVYF-------------EGVIPPEEMADQPFGMYSLPNSFLSLFIIGSTENWTDILYALQKHSP 967

Human   962 -VAGQAMCLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHKGVAY 1025
             ::....|...|::..::.|.|:||:|:||:..|...       .:.|....||    .|    |
Yeast   968 NISSTFFCSVFFIIWFLLSNSVILNIFIALISESMEV-------KEEEKRPQQI----KH----Y 1017

Human  1026 VK----RKIYEFIQQSFIR--KQKILDEIKPLDDLNNK----KDSCMSNHTAEIGKDLD------ 1074
            :|    :||.|:...|.:.  ::|.....:..|..:.|    :.:.:.|....:|:..|      
Yeast  1018 LKFVYPQKIQEYTHASLVARIRKKFFGGHRNEDTRDFKQFLMRGTAIMNIAQNMGELADEFKEPP 1082

Human  1075 ----YLKDVNGTTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSE 1135
                :.|.::..|.|:   .|:::       ...|.|||...        .||.....|.|.:..
Yeast  1083 SENLFKKGLSKLTIGV---PSLKR-------LRMFANNPFYK--------NSDVVFTETNDINGR 1129

Human  1136 SDLEESKEKLNESSSSSEGSTVDIGAPVEEQPVVE-PEETLEPEACFTEGCVQRFKCCQINVEEG 1199
            :.:.|    |||    .|...:|.   :::.|:.. ......|:..|     :||  ||..|...
Yeast  1130 TYILE----LNE----YEDEKLDY---LKKYPLFNYSYYFFSPQHRF-----RRF--CQRLVPPS 1176

Human  1200 RGKQ------------WWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTML 1252
            .||:            .:| :|:.|..:|.:.|    ||:..|::..|.....|:.....:...:
Yeast  1177 TGKRTDGSRFFEDSTDLYN-KRSYFHHIERDVF----VFIFALATILLIVCSCYVTPLYRMHHKM 1236

Human  1253 ------EYADKVFTYIFILEMLLKWVAYGY----QTYFTNAWCWLDFLIVDVSLVSLTANALGY- 1306
                  ...|..|...|.:|.::|.||.|:    ..|..|.|.::||.:    |:|:..|.:.| 
Yeast  1237 GTWNWSSALDCAFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDFCV----LISMWINLIAYL 1297

Human  1307 ---SELGAIKSLRTLRALRPLRALSRFEGMRVVVN-ALLGAIPSIMNVLLVCLIFWLIFSIMGVN 1367
               ..|..|  .:.|.|||.||.|:.....|...| .:...:..|....|:.|.....|::.|::
Yeast  1298 KNNGNLSRI--FKGLTALRALRCLTISNTARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLS 1360

Human  1368 LFAGKFYHCINTTTGDRFDIEDVNNHTDCLKLIERNETARW--------KNVKVNFDNVGFGYLS 1424
            :|.|:...|.:.:.|          ..||..... |...:|        :...::.|:....:.|
Yeast  1361 IFKGRLGTCNDGSLG----------RADCYNEYS-NSVFQWDIMSPRVYQQPYLHLDSFASAFSS 1414

Human  1425 LLQVATFKGWMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQ 1489
            |.|:.:.:||:|::...::|..:........|....|:.|:|......|.||||:..|::|   |
Yeast  1415 LYQIISLEGWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMVFILNLFVSFIVNN---Q 1476

Human  1490 KKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIP------------------------------ 1524
            .:..|  ..:.|.|:|.:..:.|.|...|| |.||                              
Yeast  1477 ARTTG--SAYFTIEEKAWLESQKLLSQAKP-KAIPNLIELSRVRQFFYQLAVEKKNFYYASFLQV 1538

Human  1525 --------------RPGN--KFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQSEYVTTIL 1573
                          .|||  .:||:.|.|.| .||.|...:.:|         .:....|.....
Yeast  1539 VLYLHIIMLLSRSYNPGNLIGYQGVYFMFST-SVFLIQEALHMC---------GEGPRLYFRQKW 1593

Human  1574 SRINL-VFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELIEKYFVSP---TL 1634
            :.|.| :.|:.|....|...:...||:|.             :|.|.||  |:...|:.|   ||
Yeast  1594 NSIRLSIIIIAFIMNAVAFHVPASHYWFH-------------NIKGFFL--LVIFLFIIPQNDTL 1643

Human  1635 FRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREV 1699
            ..::..|                      |.|||.:.::.....::..:|||.....|...:...
Yeast  1644 TELLETA----------------------MASLPPILSLTYTWGVLFLVYAIALNQIFGLTRLGS 1686

Human  1700 GIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNKVNPGSSVKGDCGNPSVGIF 1764
            ...|..||.|...|||.||:.:...||:.::|.:..|: |.|.    :..:|...|||:.:....
Yeast  1687 NTTDNINFRTVIKSMIVLFRCSFGEGWNYIMADLTVSE-PYCS----SDDNSTYTDCGSETYAYL 1746

Human  1765 FFVSYIIISFLVVVNMYIAVILENFSVATEE--SAEPLSEDDFEMFYEVWEKFDPDATQFMEFEK 1827
            ..:|:.|||..:.|||::::|:.|||.....  |...::..:.:.:.|.|.|||.|.|..:|...
Yeast  1747 LLMSWNIISMYIFVNMFVSLIIGNFSYVYRSGGSRSGINRSEIKKYIEAWSKFDTDGTGELELSY 1811

Human  1828 LSQFAAALEPPLN 1840
            |.:...:.:.||:
Yeast  1812 LPRIMHSFDGPLS 1824

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 93/454 (20%)
Ion_trans 127..433 CDD:306908 81/415 (20%)
Na_trans_cytopl 510..705 CDD:314757 16/196 (8%)
II. {ECO:0000305} 750..1022 53/296 (18%)
Ion_trans 767..980 CDD:306908 37/237 (16%)
Na_trans_assoc 1006..1213 CDD:310839 47/240 (20%)
III. {ECO:0000305} 1200..1514 78/349 (22%)
Ion_trans 1217..1492 CDD:306908 67/298 (22%)
Na_channel_gate 1484..1536 CDD:240441 19/98 (19%)
IV. {ECO:0000305} 1523..1821 79/350 (23%)
Ion_trans 1540..1796 CDD:306908 61/262 (23%)
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571 1/10 (10%)
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636 7/20 (35%)
GPHH 1800..1863 CDD:318993 11/42 (26%)
CCH1NP_011733.3 Ion_trans 486..722 CDD:278921 58/274 (21%)
Ion_trans 795..1010 CDD:278921 50/310 (16%)
Ion_trans 1228..1480 CDD:278921 61/272 (22%)
Ion_trans 1566..1776 CDD:278921 63/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I511
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.952 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.