DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and scn1lab

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:NP_001038360.2 Gene:scn1lab / 559447 ZFINID:ZDB-GENE-060906-1 Length:1996 Species:Danio rerio

Alignment Length:2023 Identity:1576/2024 (78%)
Similarity:1769/2024 (87%) Gaps:48/2024 (2%)


Human     1 MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKK--DDDENGPKPNSDLEAGKNLPF 63
            |...:|||||||||..|..|||||||:|||||.|:.||.:::  ||||||||||.||||||.|||
Zfish     1 MAAQLLVPPGPDSFRPFLPESLAAIEQRIAEEVAQRPKGERRPDDDDENGPKPNRDLEAGKPLPF 65

Human    64 IYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS 128
            ||||:||.|:|.||||||.||.|:|||||||:|||||||:||.|||||:||||||:|:|::||||
Zfish    66 IYGDVPPHMLSVPLEDLDTYYSNQKTFIVLNRGKAIFRFNATPALYILSPFNPLRRISIRVLVHS 130

Human   129 LFSMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWL 193
            |||.:|||||||||.|||:||||:|.|||||||||||||||||||:|||||:..|||||||||||
Zfish   131 LFSFVIMCTILTNCAFMTLSNPPEWAKNVEYTFTGIYTFESLIKILARGFCVGKFTFLRDPWNWL 195

Human   194 DFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCL 258
            ||:||..|||||||:||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish   196 DFSVILMAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCL 260

Human   259 SVFALIGLQLFMGNLRNKCIQWPPTNASLEEHSIEKNITVNYNGTLINETVFEFDWKSYIQDSRY 323
            ||||||||||||||||.||::.|..|       :..|:| :|:..|.|.|   |:|..||.||..
Zfish   261 SVFALIGLQLFMGNLRQKCVKMPEVN-------VTDNLT-DYSTELHNST---FNWTEYISDSNN 314

Human   324 HYFLEGFLDALLCGNSSDAGQCPEGYMCVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLY 388
            :||:.|..|||||||||||||||||:.|:||||||:|||||||||||||||||||||||||||||
Zfish   315 YYFIPGRRDALLCGNSSDAGQCPEGFTCIKAGRNPDYGYTSFDTFSWAFLSLFRLMTQDFWENLY 379

Human   389 QLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMIEQLKK 453
            |.|||||||.||||||||||||||||:|||||||||||:||||||:|||:|||.|||.|:||||:
Zfish   380 QQTLRAAGKPYMIFFVLVIFLGSFYLVNLILAVVAMAYDEQNQATIEEAQQKEEEFQAMLEQLKR 444

Human   454 QQEAAQQAATATASEHSREPSAAGRLS-DSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDE 517
            |||.||.|| |.|:| |.|.|..|.|| :|||..|:||||||||||||||||||:|:.  |:.|:
Zfish   445 QQEEAQVAA-AAATE-SGEYSGRGGLSEESSSGGSRLSSKSAKERRNRRKKRKQREEE--EKADQ 505

Human   518 DEFQKSESEDSIRRKGFRFSIEGNRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAK 582
            ::|.||.|||||||.||||||:.|||:|||:.|:|:||||||||||||||||||.|||||||||:
Zfish   506 EKFHKSASEDSIRRPGFRFSIDANRLSYEKKCSTPNQSLLSIRGSLFSPRRNSRASLFSFRGRAR 570

Human   583 DVGSENDFADDEHSTFEDNESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDC 647
            |.||||||||||||||||::|||.||||| |..|||:|.:|..|.::..: :.|||||||.||||
Zfish   571 DFGSENDFADDEHSTFEDSDSRRGSLFVP-RCVERRSSTVSHCSLTAPRI-MLPANGKMHCTVDC 633

Human   648 NGVVSLVGGPSVPTSPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQR 712
            |||||||||.||||||:|:||||           |||||:::||:||.| |...|:||:...|:|
Zfish   634 NGVVSLVGGTSVPTSPIGRLLPE-----------GTTTESDVRKKRSGS-HQPSDYLEETVARKR 686

Human   713 AMSIASILTNTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITIC 777
            |||:|||||||:|||||||||||||||||:|.||||||||.|||||.::|::|||||||||||||
Zfish   687 AMSVASILTNTMEELEESRQKCPPCWYKFANSFLIWDCSPAWLKVKEIMNMIVMDPFVDLAITIC 751

Human   778 IVLNTLFMAMEHYPMTDHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTL 842
            ||||||||||||||||..|:::|:||||||||||||||.||:||:|||||||||||||||.||:|
Zfish   752 IVLNTLFMAMEHYPMTTQFSHLLSVGNLVFTGIFTAEMCLKVIALDPYYYFQEGWNIFDGIIVSL 816

Human   843 SLVELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV 907
            ||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish   817 SLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVV 881

Human   908 GMQLFGKSYKDCVCKIASDCQLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVF 972
            |||||||||::|||||:..|:||||||:||||||||||||||||||||||||||||||:|||.||
Zfish   882 GMQLFGKSYRECVCKISESCELPRWHMDDFFHSFLIVFRVLCGEWIETMWDCMEVAGQSMCLIVF 946

Human   973 MMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHKGVAYVKRKIYEFIQQS 1037
            ||||||||||||||||||||||||||||||||||:|||||||||.|:.||:|.||..:.:|:|..
Zfish   947 MMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDSEMNNLQIAVGRIQKGIALVKSTLRQFLQSL 1011

Human  1038 FI--RKQKILDEIKPLDDLNNK-KDSCMSNHTAEIGKDL--DYLKDVNGTTS-GIGTGSSVEKYI 1096
            |:  .|.:.|||.||||||::. |::|:||| |.:..||  ||||:  |..| |.|..|.| ||.
Zfish  1012 FLAGSKPRSLDEEKPLDDLHSDGKENCLSNH-APVAVDLTKDYLKE--GCVSPGNGVESHV-KYG 1072

Human  1097 IDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSE-SDLEESKEKLNESS--SSSEGSTVD 1158
            |:|.||||||:|||||||||||||||||||||||||||| ||:|.|||||...:  |||||||||
Zfish  1073 IEEGDYMSFIHNPSLTVTVPIAVGESDFENLNTEDFSSESSDVEGSKEKLPVDTVLSSSEGSTVD 1137

Human  1159 IGAPVE--EQPVVEPEETLEPEACFTEGCVQRFKCCQINVEEGRGKQWWNLRRTCFRIVEHNWFE 1221
            |..|.|  |...:||||:|:||||||||||.||:|||::||:|:.|.||.||:|||.||||||||
Zfish  1138 IRPPGEGAESVELEPEESLDPEACFTEGCVMRFQCCQVDVEKGKWKSWWILRKTCFIIVEHNWFE 1202

Human  1222 TFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGYQTYFTNAWCW 1286
            :||:|||||||||||||||||:|||||||:||||||||||||||||||||||||:..||||||||
Zfish  1203 SFIIFMILLSSGALAFEDIYIEQRKTIKTVLEYADKVFTYIFILEMLLKWVAYGFAKYFTNAWCW 1267

Human  1287 LDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL 1351
            |||||||||||||.|||||||||.|||||||||||||||||||||||||||||||||||||||||
Zfish  1268 LDFLIVDVSLVSLVANALGYSELSAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVL 1332

Human  1352 LVCLIFWLIFSIMGVNLFAGKFYHCINTTTGDRFDIEDVNNHTDCLKLIERNETARWKNVKVNFD 1416
            |||||||||||||||||||||:|:|:|.|..:.|.:..|||.:||..||:.|:||||||||:|||
Zfish  1333 LVCLIFWLIFSIMGVNLFAGKYYYCVNITNDELFPVSVVNNKSDCYALIQNNDTARWKNVKINFD 1397

Human  1417 NVGFGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGV 1481
            |||.|||:|||||||||||||||||||||::|.||.||.:|||||||||||||||||||||||||
Zfish  1398 NVGAGYLALLQVATFKGWMDIMYAAVDSRDLEQQPVYETNLYMYLYFVIFIIFGSFFTLNLFIGV 1462

Human  1482 IIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDIS 1546
            |||||||||||.|||||||||||||||||||||||||||||||||.|||||:|||.:|:|.|||.
Zfish  1463 IIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPANKFQGLVFDLITKQAFDII 1527

Human  1547 IMILICLNMVTMMVETDDQSEYVTTILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVV 1611
            |||||||||||||||||||:|.:..||..||||||:|||||||||:||||||:||||||:|||||
Zfish  1528 IMILICLNMVTMMVETDDQTEDMDNILYWINLVFIILFTGECVLKMISLRHYFFTIGWNVFDFVV 1592

Human  1612 VILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLL 1676
            ||||||||||:|:||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish  1593 VILSIVGMFLSEMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLL 1657

Human  1677 LFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDC 1741
            ||||||||||||||||||||||.|||||||||||||||:||||||||||||||||||||.:.|||
Zfish  1658 LFLVMFIYAIFGMSNFAYVKREAGIDDMFNFETFGNSMLCLFQITTSAGWDGLLAPILNKQDPDC 1722

Human  1742 DPNKVNPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFE 1806
            |....:|||..:|:|||||||||||||||||.||:||||||||||||||||||||||||||||||
Zfish  1723 DSEMEHPGSFYRGNCGNPSVGIFFFVSYIIICFLIVVNMYIAVILENFSVATEESAEPLSEDDFE 1787

Human  1807 MFYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGDRIHCLDILFAF 1871
            |||||||:|||:||||:|:.|||.||.||:|||.:.:|||:||||||||||||||||||||||||
Zfish  1788 MFYEVWERFDPNATQFVEYNKLSDFADALDPPLRIAKPNKIQLIAMDLPMVSGDRIHCLDILFAF 1852

Human  1872 TKRVLGESGEMDALRIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAVIIQRAYRRHLLKRTVK 1936
            |.|||||.|||||||.|||:||||||||||||:||||||:|||||:|||:||||:|||.:::|||
Zfish  1853 TLRVLGEEGEMDALRGQMEDRFMASNPSKVSYEPITTTLRRKQEEMSAVVIQRAFRRHRIRQTVK 1917

Human  1937 QASFTYNKNKIKGGANLLIKEDMIIDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEKHEQEG 2001
            :||..|.|....||.::..||.::|.:..|||.::|||:|.|:|: ||||:.|.|...:|:|:|.
Zfish  1918 KASEAYRKQLQDGGGHIPEKEVLVIGKFQENSASDKTDMTPSSAS-PPSYNSVAKSEKDKYEKER 1981

Human  2002 KDEKAKGK 2009
            ::::.|.|
Zfish  1982 REKEDKAK 1989

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 273/344 (79%)
Ion_trans 127..433 CDD:306908 246/306 (80%)
Na_trans_cytopl 510..705 CDD:314757 129/195 (66%)
II. {ECO:0000305} 750..1022 241/272 (89%)
Ion_trans 767..980 CDD:306908 192/213 (90%)
Na_trans_assoc 1006..1213 CDD:310839 137/218 (63%)
III. {ECO:0000305} 1200..1514 270/314 (86%)
Ion_trans 1217..1492 CDD:306908 238/275 (87%)
Na_channel_gate 1484..1536 CDD:240441 49/52 (94%)
IV. {ECO:0000305} 1523..1821 260/298 (87%)
Ion_trans 1540..1796 CDD:306908 224/256 (88%)
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571 6/10 (60%)
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636 15/17 (88%)
GPHH 1800..1863 CDD:318993 50/63 (79%)
scn1labNP_001038360.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 3177 1.000 Inparanoid score I126
OMA 1 1.010
OrthoDB 1 1.010 D13587at7742
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126819
Panther 1 1.100 O PTHR10037
Phylome 1 0.910 0.909 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9280
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.