DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and cch1

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:NP_593894.1 Gene:cch1 / 2542812 PomBaseID:SPAC6F6.01 Length:1854 Species:Schizosaccharomyces pombe

Alignment Length:2054 Identity:394/2055 (19%)
Similarity:718/2055 (35%) Gaps:698/2055 (34%)


Human    62 PFIYGDIPP-------EMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRK 119
            ||::..:.|       |:.:..|..:.|...|:      ..|:.:             ||:|:.:
pombe   134 PFLFDKLSPYFTHFFSEIYAAVLRVVGPPRANE------TPGRNL-------------PFSPILR 179

Human   120 IAIKILVHSLFSMLIMCTILTNCVFMTM--SNPPDWTKNVEYTFTGI---YTFESLIKIIARGFC 179
               :|..|.|:::.|...|:.:.|.:.:  .:|.|.::.::|....|   ||.|.|:||...||.
pombe   180 ---QIYNHPLYNIFIFVVIVLHAVLLMIRSDDPHDKSQTIDYLIIVIGILYTLEMLLKIYLFGFL 241

Human   180 LE------DF------------TFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRV---LRA 223
            .:      ||            ::||..||.:||..|...::: .:........|.|.:   ||.
pombe   242 YDGSSSFYDFINSYTKKTPRTMSYLRHSWNRVDFVAIVALWIS-VIGKKQQGIFRLFSMIACLRL 305

Human   224 LKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCI-------QWP 281
            .:.:::....:||:.:|.:|...|..|:....|...:.|::|:|.|..:|..:|:       |:.
pombe   306 TRLLNITRKTETILKSLKESSTPLVQVVSFNAFFGVMIAILGVQFFKASLNRQCVWLGDYGDQYL 370

Human   282 PTNASLEEHSIEKNITVNYNGTLINETVFEFDWKSYIQDSRYHYFLEGFLDALLCGNSSDAGQCP 346
            ||......|                       |::.|:        ..:||.    |...:...|
pombe   371 PTGQFCGGH-----------------------WENGIK--------RAYLDK----NGFPSNVNP 400

Human   347 EGYMCVKAG-----RNPNYGYTSFDTFSWAFLSLFRLMTQD-FWENLYQLTLRAAGKTYMIFFVL 405
            .|::|.:..     .||.....|||.|..:...:|.:|:.: |.:.:|.:.......:.::|.:.
pombe   401 RGFICAEKSVCRVVENPYSNTVSFDNFFNSLELIFVIMSSNGFTDIMYDIMDAEYFVSCLLFIIS 465

Human   406 VIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMIEQLKKQQEAAQQAATATASEHS 470
            ..|| :.:|::|::|||..::.:                                      .:||
pombe   466 AYFL-TLWLMSLVIAVVTSSFID--------------------------------------LQHS 491

Human   471 REPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFQKSESEDSIRRKGFR 535
                                            .:.|||            |||..:..||.|   
pombe   492 --------------------------------GKNQKE------------QKSVDKHLIRNK--- 509

Human   536 FSIEGNRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFED 600
                                                                             
pombe   510 ----------------------------------------------------------------- 509

Human   601 NESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGGPSVPTSPVG 665
                                                                             
pombe   510 ----------------------------------------------------------------- 509

Human   666 QLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILTNTVEELEES 730
                  :.:|                                                       
pombe   510 ------LCEK------------------------------------------------------- 513

Human   731 RQKCPPCWYKFSNIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTDH 795
                    |.|.:.| ||            ::.:|..     .:|:|               |..
pombe   514 --------YLFYSNF-IW------------ISFIVAQ-----FVTLC---------------TQT 537

Human   796 FNNVLTVGN--LVFTG----IFTAEMFLKIIAMDPYY--YFQEGWNIFDGFIVTLSLVELGLANV 852
            ::...:..|  |:|..    :..||:.|:..|..|.|  :|:...|:.|..:..|:||.| |.::
pombe   538 YDQTSSTANRYLIFYACVDFLLAAEVILRFFAYLPDYRLFFRRYTNLVDIVLAVLNLVTL-LPSI 601

Human   853 EGLSV----LRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLF- 912
            ....|    |..|.:.|:::.....|....:.|::.::...|.||.|.|.|::||.::..::|| 
pombe   602 RKNPVAFGWLSIFAIARIYRCILLIPYTRKIAKLLFSNFKQLLNLMLFLVIVLFIASLCAVRLFQ 666

Human   913 -----GKSYKDCVCKIASDCQLPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCMEVAGQAMCL-- 969
                 |.|..|.:....:            :.|||.::::|..| |.:.|:     |.||...  
pombe   667 DLPNDGDSDDDAISFATT------------YESFLYMYQILTSENWTDVMF-----AIQARLAHL 714

Human   970 -------TVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHKGV--AY 1025
                   ..|.:..:..|.|||::|:|::..:|     |.::.|.:|..|::.:.|:.:..  ..
pombe   715 HLSWIPGAFFTLWFLFSNNVVLSMFIAVIQVNF-----APSESDLKMEQLKMYLARLLRNYNPFQ 774

Human  1026 VKRKIYEFIQQSFIRKQKILDEIKPLDDLNNKKDSCMSNHTAEIGKDLDYLKDVNGTTS------ 1084
            ....:...|:::..||.|.:||                :|...:.:| :.:|.....|:      
pombe   775 ASLTLNALIKRNGSRKGKTVDE----------------SHYEWLYED-NIIKGFLRVTNIPPKEP 822

Human  1085 ---GIGTGSSVEKYIIDE--SDYMSFI--NNPSLTVTVPIAVG---ESDFENLNTEDFSSESDLE 1139
               .:.|...:.||.:.:  :::..|:  ::|.........:|   |.|. ||.|    :..|::
pombe   823 LKPSLDTSPELSKYSLAKLSNNFKRFVMRDDPFSQAYFKRVIGIRWEKDM-NLKT----AAKDMQ 882

Human  1140 ESKEKLNESSSSSEGSTVDIGAPVEEQP-------VVEPEETLEPEACFTEGCVQRFKCCQINVE 1197
            .:|..:....:..          ::..|       |::|...           ::||  ||..|.
pombe   883 AAKAFVRIKQTEF----------LKNHPKYNDVFWVIKPSNR-----------IRRF--CQRLVM 924

Human  1198 EGRGKQWWNLR--RTCFRIVEHNWFETFIVFMILLSSGALAFEDIY--IDQRKTIKTMLEYA--- 1255
            .|..:::..:.  :..:|::     :.||...||.   |:..|.|.  |.:|..:....::|   
pombe   925 PGVNERYGGVEPYQWVYRVI-----QVFIYACILT---AVIIECIATPIYERDHLLNDKQHAWFV 981

Human  1256 --DKVFTYIFILEMLLKWVAYGY----QTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKS 1314
              :..|..||.:|..:|.:|.|:    ..|..:.|..:||.::....::|.|....::.|.  ::
pombe   982 WTEVAFATIFTIEAAIKIIADGFCITPNAYLRSTWNCIDFFVLVTLWINLYAVLTSHALLS--RA 1044

Human  1315 LRTLRALRPLRALSRFE-GMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCIN 1378
            .|..:|||.||.::..: ..|:..:||:.....|.:..:|.....:.|::...|:|.|..|.|  
pombe  1045 FRAFKALRVLRLINLTQTSQRMFHDALISGFFKIFSAAVVSATLLIPFALWAKNVFGGLLYSC-- 1107

Human  1379 TTTGDRFDIEDVNNHTDCLKLIERNETAR---------WKN-VKVNFDNVGFGYLSLLQVATFKG 1433
                   :.::|.:.:.|  ::|...|..         |.| ...:||......|:|.::|:.:|
pombe  1108 -------NDDNVLSASQC--VLEYASTPNNWEVWAPRVWSNPPDYDFDRFPHALLALFEIASIEG 1163

Human  1434 WMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDI 1498
            |:|||.:.:|......||:...|....::||:|.:....:.|.|||.:||.|:.::.     ...
pombe  1164 WVDIMRSVMDITGFNNQPQTNASSGNAMFFVLFNLVSMIYILTLFIAIIISNYAERT-----GSA 1223

Human  1499 FMTEEQKKYYNAMKKLGSKKPQK-PIPRPGNKFQGMVFDF------VTRQVFDISIMILICLNMV 1556
            |.|.||:.:....:|:.|.:|.| |..||.. .:|:.:||      :.|:.| ..:.|:..|.::
pombe  1224 FFTAEQRAWLELRRKIKSMRPSKRPAIRPLG-LRGLCYDFAVQKHGIWRRTF-TGLYIVHLLFLL 1286

Human  1557 TMMVETDDQSEYVTTILSRINLVFIVL---FTGECVLKLISLRHYYFTIG-WNIFDFVVVILSIV 1617
            |:.........||.      |.:|::|   :|....:|:..|..|||... ||:|| |||.|..:
pombe  1287 TIFYPCPIAYTYVR------NSIFLILSICYTINICVKVYGLSFYYFFHSFWNMFD-VVVTLGSL 1344

Human  1618 GMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMF 1682
            ...:|.|.:....|.||.:...|..:  .:.||........|...::.|||::|:: :..::|::
pombe  1345 TCNIAILAKFENRSLTLLQTTLLVLV--TVHLIPKFDNFDQLSKTVVASLPSIFSL-IATWIVLY 1406

Human  1683 I-YAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNKV 1746
            | :||.....|...|..:......||.:..|:::.||.:|...||:.::.....|.     ||.|
pombe  1407 ITFAIAFNQIFGLTKLGLNGGPNKNFRSIRNALVLLFTMTFGEGWNDVMHDYTISY-----PNCV 1466

Human  1747 NPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFS-VATEESA-EPLSEDDFEMFY 1809
            |.......||||.......|:::.|||..:.|||:|.|:.:||| :.|:.|: ..|..:||..|.
pombe  1467 NGDDFYNSDCGNKPWAYGLFIAWNIISMYIFVNMFITVVFDNFSYIHTKSSSFTNLQRNDFRQFK 1531

Human  1810 EVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGDRIHCLDILFAFTKR 1874
            :.|..|||..|.:                  :|:.|.:                         |.
pombe  1532 DSWAPFDPMVTGY------------------IPKRNAV-------------------------KF 1553

Human  1875 VLGESGEMDALRIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAVIIQRAYRRHLLKRTVKQAS 1939
            ||...|..| .||..:|..:.|..|||.       .|..|:.|..:                   
pombe  1554 VLSLRGVYD-FRIYRDEHTLRSIISKVQ-------SKTGQQSVPML------------------- 1591

Human  1940 FTYNKNKIKGGANLLIKEDMIIDRINENSITEKTDLTMS 1978
                :|.:.|....|...|.|||.|:.|.:.|:.::..|
pombe  1592 ----ENPLMGSEINLEALDQIIDTIDVNVVKERRNVLNS 1626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 77/383 (20%)
Ion_trans 127..433 CDD:306908 73/345 (21%)
Na_trans_cytopl 510..705 CDD:314757 7/195 (4%)
II. {ECO:0000305} 750..1022 63/300 (21%)
Ion_trans 767..980 CDD:306908 50/241 (21%)
Na_trans_assoc 1006..1213 CDD:310839 36/234 (15%)
III. {ECO:0000305} 1200..1514 77/338 (23%)
Ion_trans 1217..1492 CDD:306908 71/297 (24%)
Na_channel_gate 1484..1536 CDD:240441 13/53 (25%)
IV. {ECO:0000305} 1523..1821 88/311 (28%)
Ion_trans 1540..1796 CDD:306908 73/262 (28%)
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571 2/10 (20%)
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636 5/17 (29%)
GPHH 1800..1863 CDD:318993 11/63 (17%)
cch1NP_593894.1 Ion_trans 201..485 CDD:278921 68/321 (21%)
Ion_trans 533..748 CDD:278921 56/253 (22%)
Ion_trans 968..1220 CDD:278921 63/265 (24%)
Ion_trans 1289..1517 CDD:278921 68/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.966 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.