DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and Scn1a

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:NP_001300926.1 Gene:Scn1a / 20265 MGIID:98246 Length:2009 Species:Mus musculus

Alignment Length:2009 Identity:1972/2010 (98%)
Similarity:2000/2010 (100%) Gaps:0/2010 (0%)


Human     1 MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIY 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse     1 MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIY 65

Human    66 GDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHSLF 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    66 GDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHSLF 130

Human   131 SMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDF 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   131 SMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDF 195

Human   196 TVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSV 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   196 TVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSV 260

Human   261 FALIGLQLFMGNLRNKCIQWPPTNASLEEHSIEKNITVNYNGTLINETVFEFDWKSYIQDSRYHY 325
            |||||||||||||||||:|||||||||||||||||||::|||||:||||||||||||||||||||
Mouse   261 FALIGLQLFMGNLRNKCVQWPPTNASLEEHSIEKNITMDYNGTLVNETVFEFDWKSYIQDSRYHY 325

Human   326 FLEGFLDALLCGNSSDAGQCPEGYMCVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQL 390
            ||||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   326 FLEGVLDALLCGNSSDAGQCPEGYMCVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQL 390

Human   391 TLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMIEQLKKQQ 455
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||||
Mouse   391 TLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQ 455

Human   456 EAAQQAATATASEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEF 520
            |||||||..||||||||||||||||||||||||||||||||||||||||||||||||||||:|||
Mouse   456 EAAQQAAATTASEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDDDEF 520

Human   521 QKSESEDSIRRKGFRFSIEGNRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVG 585
            .||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   521 HKSESEDSIRRKGFRFSIEGNRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVG 585

Human   586 SENDFADDEHSTFEDNESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGV 650
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   586 SENDFADDEHSTFEDNESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGV 650

Human   651 VSLVGGPSVPTSPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMS 715
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   651 VSLVGGPSVPTSPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMS 715

Human   716 IASILTNTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVL 780
            ||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||
Mouse   716 IASILTNTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHIVNLVVMDPFVDLAITICIVL 780

Human   781 NTLFMAMEHYPMTDHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLV 845
            |||||||||||||:|||:|||||||||||||||||||||||||||||||||||||||||||||||
Mouse   781 NTLFMAMEHYPMTEHFNHVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLV 845

Human   846 ELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQ 910
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   846 ELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQ 910

Human   911 LFGKSYKDCVCKIASDCQLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVFMMV 975
            ||||||||||||||:||:|||||||||||||||||||||||||||||||||||||||||||||||
Mouse   911 LFGKSYKDCVCKIATDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVFMMV 975

Human   976 MVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHKGVAYVKRKIYEFIQQSFIR 1040
            |||||||||||||||||||||||||||||||||||||||||||||||:|||||||||||||||::
Mouse   976 MVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHKGIAYVKRKIYEFIQQSFVK 1040

Human  1041 KQKILDEIKPLDDLNNKKDSCMSNHTAEIGKDLDYLKDVNGTTSGIGTGSSVEKYIIDESDYMSF 1105
            ||||||||||||||||:||:|:||||.|||||||.||||||||||||||||||||||||||||||
Mouse  1041 KQKILDEIKPLDDLNNRKDNCISNHTTEIGKDLDCLKDVNGTTSGIGTGSSVEKYIIDESDYMSF 1105

Human  1106 INNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLNESSSSSEGSTVDIGAPVEEQPVVE 1170
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||.|||||:|
Mouse  1106 INNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLNESSSSSEGSTVDIGAPAEEQPVIE 1170

Human  1171 PEETLEPEACFTEGCVQRFKCCQINVEEGRGKQWWNLRRTCFRIVEHNWFETFIVFMILLSSGAL 1235
            ||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||
Mouse  1171 PEETLEPEACFTEGCVQRFKCCQISVEEGRGKQWWNLRRTCFRIVEHNWFETFIVFMILLSSGAL 1235

Human  1236 AFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLT 1300
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1236 AFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLT 1300

Human  1301 ANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMG 1365
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1301 ANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMG 1365

Human  1366 VNLFAGKFYHCINTTTGDRFDIEDVNNHTDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVAT 1430
            |||||||||||:||||||.|:|.:||||:||||||||||||||||||||||||||||||||||||
Mouse  1366 VNLFAGKFYHCVNTTTGDIFEISEVNNHSDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVAT 1430

Human  1431 FKGWMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGG 1495
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1431 FKGWMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGG 1495

Human  1496 QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMV 1560
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1496 QDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMV 1560

Human  1561 ETDDQSEYVTTILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELI 1625
            ||||||:|||:||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1561 ETDDQSDYVTSILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELI 1625

Human  1626 EKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS 1690
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1626 EKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMS 1690

Human  1691 NFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNKVNPGSSVKGD 1755
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1691 NFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNKVNPGSSVKGD 1755

Human  1756 CGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDAT 1820
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1756 CGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDAT 1820

Human  1821 QFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDAL 1885
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1821 QFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDAL 1885

Human  1886 RIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAVIIQRAYRRHLLKRTVKQASFTYNKNKIKGG 1950
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||
Mouse  1886 RIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAVIIQRAYRRHLLKRTVKQASFTYNKNKLKGG 1950

Human  1951 ANLLIKEDMIIDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEKHEQEGKDEKAKGK 2009
            ||||:||||:|||||||||||||||||||||||||||||||||||||||||||||||||
Mouse  1951 ANLLVKEDMLIDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEKHEQEGKDEKAKGK 2009

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 338/344 (98%)
Ion_trans 127..433 CDD:306908 301/306 (98%)
Na_trans_cytopl 510..705 CDD:314757 193/195 (99%)
II. {ECO:0000305} 750..1022 267/272 (98%)
Ion_trans 767..980 CDD:306908 209/213 (98%)
Na_trans_assoc 1006..1213 CDD:310839 196/207 (95%)
III. {ECO:0000305} 1200..1514 308/314 (98%)
Ion_trans 1217..1492 CDD:306908 269/275 (98%)
Na_channel_gate 1484..1536 CDD:240441 52/52 (100%)
IV. {ECO:0000305} 1523..1821 296/298 (99%)
Ion_trans 1540..1796 CDD:306908 254/256 (99%)
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571 9/10 (90%)
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636 17/17 (100%)
GPHH 1800..1863 CDD:318993 63/63 (100%)
Scn1aNP_001300926.1 I. {ECO:0000250|UniProtKB:P04774} 110..454 338/344 (98%)
Ion_trans 149..433 CDD:278921 279/284 (98%)
Na_trans_cytopl 510..627 CDD:288761 115/117 (98%)
II. {ECO:0000250|UniProtKB:P04774} 750..1022 267/272 (98%)
Ion_trans 785..980 CDD:278921 191/195 (98%)
Na_trans_assoc 1006..1213 CDD:284034 196/207 (95%)
III. {ECO:0000250|UniProtKB:P04774} 1200..1514 308/314 (98%)
Ion_trans 1235..1492 CDD:278921 251/257 (98%)
Na_channel_gate 1484..1536 CDD:240441 52/52 (100%)
IV. {ECO:0000250|UniProtKB:P04774} 1523..1821 296/298 (99%)
Ion_trans 1558..1796 CDD:278921 236/238 (99%)
S1-S2 loop of repeat IV. {ECO:0000269|PubMed:27281198} 1561..1571 9/10 (90%)
S3b-S4 loop of repeat IV. {ECO:0000269|PubMed:27281198} 1619..1636 17/17 (100%)
GPHH 1808..1863 CDD:293510 55/55 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C369882709
eggNOG 1 0.900 E1_KOG2301
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H21375
Inparanoid 1 1.050 3950 1.000 Inparanoid score I267
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D10241at32523
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 1 1.000 T2454584
orthoMCL 1 0.900 OOG5_126819
Panther 1 1.100 LDO PTHR10037
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9280
TreeFam 1 0.960
1515.300

Return to query results.
Submit another query.