DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and cca-1

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:NP_001024497.1 Gene:cca-1 / 181045 WormBaseID:WBGene00000367 Length:1885 Species:Caenorhabditis elegans

Alignment Length:2055 Identity:502/2056 (24%)
Similarity:848/2056 (41%) Gaps:569/2056 (28%)


Human   104 ATSALYILTPFNPLRKIAIKILVHSLFSMLIMCTILTNCVFMTMSNP----PDW----------T 154
            |..||.......|.||.|:::::...|..:.|..|:.|||.:.|..|    ||.          .
 Worm   106 AEPALRCFYQARPPRKWALQMVMSPWFDRITMAVIMINCVTLGMYRPCEDGPDCDTYRCQILDII 170

Human   155 KNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFV---DLG---NVS 213
            .|..:.:   :.||.:|||:|.|| .....::.|.||.|||.:: .|.:.|||   .||   |::
 Worm   171 DNCIFVY---FAFEMVIKIMALGF-YGPAAYMSDTWNRLDFFIV-MAGIAEFVLHEYLGGNINLT 230

Human   214 ALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKC- 277
            |:||.||||.|:.::.||.::.:|..|:.::..|.:|::|..|...:|.::|:||:.|.|||:| 
 Worm   231 AIRTVRVLRPLRAVNRIPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCV 295

Human   278 IQWPPT----------NASLEEHSIEKNITVNY---------------------NGTLINETVFE 311
            |..|.|          |..|....|.::.::.|                     :|...|.|:.|
 Worm   296 INLPKTISENQSALFNNVKLTRFYIPEDTSLEYICSQPDANGLHTCSNLPPYTVDGVKCNLTLDE 360

Human   312 FD---------WKSYIQDSRYHYFLEGFLDALLCGNSSDAGQCPEGYMCVKAGRNPNYGYTSFDT 367
            :|         |..|..:                              |....|||..|..|||.
 Worm   361 YDKVTNDSCINWNIYYNE------------------------------CQVMQRNPFQGSVSFDN 395

Human   368 FSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQA 432
            ..:|::::|.:::.:.|.::......|......|:|||:|.:|:|::|||.|.|:|..:      
 Worm   396 IGFAWVAIFLVISLEGWTDIMYYVQDAHSFWNWIYFVLLIVIGAFFMINLCLVVIATQF------ 454

Human   433 TLEEAEQKEAEFQQMIEQLKKQQEAAQQAAT------ATASEHSREPSAA-----GRLSDSSSEA 486
                ||.|..|.::|:::.|........:.|      |::.|......||     |.....:..|
 Worm   455 ----AETKRRETERMLQERKMLLNRDSISCTGSEIGGASSKEEGDTVYAAFVRFIGHTFRRTKRA 515

Human   487 SK------LSSKSAKERRNRRKKRKQK----------EQSGGEEKDEDEFQKSESEDSIRRKGFR 535
            :|      :..::.::...|:::||.|          |:...:|:||....:...:|.|.:.|  
 Worm   516 AKKKYTAYMEERAERKSSERQQRRKSKLDDMATLSRIEEKAEDEEDETTITRENGDDQIEQNG-- 578

Human   536 FSIEGNRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFED 600
               :|.|:...|....|                           :.| :|:.|            
 Worm   579 ---DGVRIKRVKIEEEP---------------------------KIK-IGNGN------------ 600

Human   601 NESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGK--MHSTVDCNGVVSLVGGPSVPTSP 663
                                                :||.  .||:.|                 
 Worm   601 ------------------------------------SNGPHYKHSSSD----------------- 612

Human   664 VGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILTNTVEELE 728
                        ..:|::|.                     ||                .|.:.|
 Worm   613 ------------EESDEDGE---------------------ED----------------QVYDGE 628

Human   729 ESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMT 793
            |:::|..|.        .:|     |.:.| :...|:.|.|. ..|.:.|::|||.|.:|::...
 Worm   629 EAKKKSTPS--------KLW-----WFREK-IQKFVICDHFT-RGILVAILVNTLSMGVEYHQQP 678

Human   794 DHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLVELGLANVEGLSVL 858
            :....:|...||.||.:|..||.|||||...:.|..:|:|:|||.||.||::||......|||||
 Worm   679 EILTVILEYSNLFFTALFALEMLLKIIASGLFGYLADGFNLFDGGIVALSVLELFQEGKGGLSVL 743

Human   859 RSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTL---VLAIIVFIFAVVGMQLFGKSY---- 916
            |:|||||:.||.:..|.|...:.::   :..:.|:|:   :|.:.:|||:::||.|||..:    
 Worm   744 RTFRLLRILKLVRFMPALRYQLVVM---LRTMDNVTVFFGLLVLFIFIFSILGMNLFGCKFCKVE 805

Human   917 --------KDCV----------------------CK----------------IASDCQLPRWHMN 935
                    |.|.                      ||                |:|.|:..|.:.:
 Worm   806 EKFLGGLAKKCERKNFDTLLWALITVTLGMVLFGCKFCNHPDTGLQCTSAQVISSICECDRMNFD 870

Human   936 DFFHSFLIVFRVLCGEWIETMWDCMEVAGQAM----CLTVFMMVMVIGNLVVLNLFLALLLSSF- 995
            :|..:.:.||::|..|    .|:.:...|.|.    ....|:.:|..||.|:.||.:|:|:..| 
 Worm   871 NFLFATVTVFQILTQE----DWNMVLFNGMAQTNPWAALYFVALMTFGNYVLFNLLVAILVEGFQ 931

Human   996 ------------SADNLAATDDDNEMNNLQIAVDR-----MHKGVAYV----------------- 1026
                        .|...|..::|.....|::.:.:     .:.|||..                 
 Worm   932 ESKEEEKRQLEEDARKQAVEEEDERKRELELIIAKTTSPAFNNGVAPAECTCQRPSSPEESPSPR 996

Human  1027 ----------KRKIYEFIQQSFIRKQKILDEIKPLDD---LNNKKDSCMSNHTA---EIGKDLDY 1075
                      :|| :.....:.|.|:.:|....|.|.   ...:.||.::.|.:   .:...:.|
 Worm   997 LLSANYHPSPERK-HSANLDAIIDKRLVLRNSAPFDRSPVSEGRDDSRLNRHASLVLPVANGVPY 1060

Human  1076 LKDVNGTTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEE 1140
            .:....:.||                 :....||:..|....|:         .|.::.|..||.
 Worm  1061 RRQRVHSWSG-----------------LCHHFNPNCPVHGRRAL---------IETYAREKFLEA 1099

Human  1141 SKEKLNESSSSSEGSTVDIGAPVEEQPVVEPEETLE-PEACFTEGCVQRFKCCQINVEE------ 1198
            |:|.                    :|.:.|.|:..| .:..|....::  |.|..|..|      
 Worm  1100 SQEL--------------------KQALAEEEKRNEAKQNTFVRKLLK--KTCLHNRTEFSLFLM 1142

Human  1199 GRGKQWWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYIF 1263
            |....   ||..|.:..:..||:..::|.|.::...||.|...|......:..|..:..:||.||
 Worm  1143 GPKNP---LRIKCLQTTQKKWFDYTVLFFIGINCITLAMERPSIPPDSFERQFLHISGYIFTVIF 1204

Human  1264 ILEMLLKWVA----YGYQTYFTNAWCWLDFLIVDVSLVSLTANALGYSE----LGAIKSLRTLRA 1320
            ..||::|.:|    .|...||.:.|..||.::|.:||:::....|...:    .|.|:.||.|||
 Worm  1205 TGEMMMKVIANGCFIGQAAYFKDGWNILDGILVVISLINIAFELLATGDSPKIFGVIRVLRLLRA 1269

Human  1321 LRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTTTGDRF 1385
            |||||.::|..|:::||..|:.::..|.|::|:|..|::||.|:||.||.|..||||....|   
 Worm  1270 LRPLRVINRAPGVKLVVMTLISSLKPIGNIVLICCTFFIIFGILGVQLFKGMMYHCIGPEVG--- 1331

Human  1386 DIEDVNNHTDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYAAVDSRNVELQ 1450
               :|....||:: ..||   :|.|.:.||||:|...:||..:::..||:.|||..:|:..|::|
 Worm  1332 ---NVTTKADCIE-DYRN---KWVNHRYNFDNLGQALMSLFVLSSKDGWVSIMYQGIDAVGVDVQ 1389

Human  1451 PKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLG 1515
            |....:.:..:||:.|::...||.||:|:||:::||::.|:....:    ..|::|.....:||.
 Worm  1390 PIENYNEWRMIYFISFLLLVGFFVLNMFVGVVVENFHKCKEALEKE----MREKEKEKRLKRKLK 1450

Human  1516 SKKPQKPIPRPGNKFQG-------------MVFDFVTRQVFDISIMILICLNMVTMMVETDDQSE 1567
            .:|.::.:.....|.:.             .:...||.:.||::|..:|.:|:::|.:|......
 Worm  1451 RQKFEESMAGKRKKMERNYPYYHDYGHTRLFLHGIVTSKYFDLAIAAVIGINVISMAMEFYMMPM 1515

Human  1568 YVTTILSRINLVFIVLFTGECVLKLISLRHYYFTI-GWNIFDFVVVILSIVGMFLAEL-IEKYFV 1630
            .:..:|..:|..|..:||.|..:|||:|....|.| .||..|..:|||||.|:...|. ..:..:
 Worm  1516 GLKYVLKALNYFFTAVFTLEAAMKLIALGFKRFFIEKWNRLDMFIVILSIAGIIFEEFEALELPI 1580

Human  1631 SPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYV 1695
            :||:.||:|:.||.|:|:|:|.|||||:||..:..:||.:.|:|.|.||:.||:|..|:..|.  
 Worm  1581 NPTIIRVMRVLRIARVLKLLKMAKGIRSLLDTVGEALPQVGNLGSLFFLLFFIFAALGVELFG-- 1643

Human  1696 KREV-------GIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPN---KVNPGS 1750
            |.|.       |:.:..:|:.||.:.:.||:|.|...|:|::...|..   |||.:   :.|   
 Worm  1644 KLECSEDHPCDGLGEHAHFKNFGMAFLTLFRIATGDNWNGIMKDALRD---DCDSSDHCETN--- 1702

Human  1751 SVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVA----TEESAEPL----------S 1801
                .|.:|.:...|||.:::||..|:||:.:||::::...:    .|..|||.          |
 Worm  1703 ----CCVDPILAPCFFVIFVLISQFVLVNVVVAVLMKHLEESNKRDAEGPAEPTGENIENEITKS 1763

Human  1802 EDDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALE-PPLNLPQPN----KLQLIAMDLPMVSGDR 1861
            :||     |:.|:.:|.|.:.::..:|.:.....| |...:|..:    :|.:..::..::..:|
 Worm  1764 DDD-----EIVEEHEPLAIEHVKEGELDEEEETEEGPTTQIPDGHGGIKRLSMQVLEQELIEVER 1823

Human  1862 IHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKV 1901
             | |:..:......||  ||:..|           ||.::
 Worm  1824 -H-LEERYRRASECLG--GELQPL-----------NPGEI 1848

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 106/405 (26%)
Ion_trans 127..433 CDD:306908 96/367 (26%)
Na_trans_cytopl 510..705 CDD:314757 20/197 (10%)
II. {ECO:0000305} 750..1022 93/347 (27%)
Ion_trans 767..980 CDD:306908 79/270 (29%)
Na_trans_assoc 1006..1213 CDD:310839 41/252 (16%)
III. {ECO:0000305} 1200..1514 104/322 (32%)
Ion_trans 1217..1492 CDD:306908 98/283 (35%)
Na_channel_gate 1484..1536 CDD:240441 9/65 (14%)
IV. {ECO:0000305} 1523..1821 102/337 (30%)
Ion_trans 1540..1796 CDD:306908 89/272 (33%)
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571 1/10 (10%)
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636 3/18 (17%)
GPHH 1800..1863 CDD:318993 13/78 (17%)
cca-1NP_001024497.1 Ion_trans 157..461 CDD:278921 91/349 (26%)
Ion_trans 670..938 CDD:278921 79/275 (29%)
Ion_trans 1176..1430 CDD:278921 94/264 (36%)
Ion_trans 1506..1721 CDD:278921 77/227 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.