DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and unc-2

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:NP_001355464.1 Gene:unc-2 / 180570 WormBaseID:WBGene00006742 Length:2171 Species:Caenorhabditis elegans

Alignment Length:2110 Identity:510/2111 (24%)
Similarity:847/2111 (40%) Gaps:583/2111 (28%)


Human    20 ESLAAIERRIAEEK-----AKNPKPDKK---DDDENGPKPN-------SD-----------LEAG 58
            |||:|.|...:.|:     :::|.....   ||:.....|:       ||           .||.
 Worm   123 ESLSAQEAASSSERGEHTNSRSPSTSYSSCIDDERKFSSPHRRRVVDVSDHKTCALLMTRMKEAS 187

Human    59 KNLPFIYGDIPPEMVSEPL---EDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKI 120
            :.||     .|.::.:|..   :..:.....:||.:..|   |..:....|:|:|....|.:|:.
 Worm   188 RQLP-----SPSQLAAEEARREQKAESGTFVRKTTLSSN---APVKEKGPSSLFIFAEDNIIRRN 244

Human   121 AIKILVHSLFSMLIMCTILTNCVFMTMSNP---------PDWTKNVEYTFTGIYTFESLIKIIAR 176
            |..|:....|...|:.||:.|||.::|...         .:|.:..|..|.||:..|.::|:||.
 Worm   245 AKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAF 309

Human   177 GFCLEDFTFLRDPWNWLDFTVITFAYVT------------EFVDLGNVSALRTFRVLRALKTISV 229
            ||.|...::||..||.:||.|:....||            :.||..::..||..||||.||.:|.
 Worm   310 GFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSG 374

Human   230 IPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCIQWPPTNASLEEHSIEK 294
            ||.|:.::.:::.::..|..:.:|.:|.:.:||:|||:.:.|...:.|                 
 Worm   375 IPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSAC----------------- 422

Human   295 NITVNYNGTLINETVFEFDWKSYIQDSRYHYFLEGFLDALLCGN-SSDAG--QCP-EGYMCVKAG 355
               .|..|.:  |.|.|                    ..:.|.| :|..|  .|. :|..|::..
 Worm   423 ---YNERGEI--ENVSE--------------------RPMPCTNKTSPMGVYNCDVKGTTCLQKW 462

Human   356 RNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTY-MIFFVLVIFLGSFYLINLIL 419
            ..||||.||||...:|.:::|:.:|.:.|..:...|..:.|.|| ..:|:.:|.||||:::||:|
 Worm   463 IGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVL 527

Human   420 AVVAMAYEEQNQATLEEAEQKEAEFQQMIE-QLKKQQEAAQQAATATASEHSREPSAAGRLSDSS 483
            .|::..:.::.:......|..:...||.|| :|....|....|......|            |.:
 Worm   528 GVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKE------------DRT 580

Human   484 SEASKLSSKSAKER-RNRRKKRKQKEQSGGEEKDEDEFQKSESEDSIRRKGFRFSIEGNRLTYEK 547
            :|..|.:...|:.| .|::.|:..|:||   .:.|::|::.|.|                  .|:
 Worm   581 TEEEKAAIMEARRRAANKKLKQASKQQS---TETEEDFEEDEDE------------------MEE 624

Human   548 RYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFEDNESRRDSLFVPR 612
            .|.                                          ||..|.||..:.|..     
 Worm   625 EYV------------------------------------------DEGGTVEDEFAERKK----- 642

Human   613 RHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGGPSVPTSPVGQLLPEVIIDKPA 677
                                     .|..||                    ||:.:.::.|    
 Worm   643 -------------------------RGCCHS--------------------VGKFIKQLRI---- 658

Human   678 TDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILTNTVEELEESRQKCPPCWYKFS 742
                      ::|                            |:..|                   
 Worm   659 ----------QIR----------------------------IMVKT------------------- 666

Human   743 NIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTDHFNNVLTVGNLVF 807
            .||       ||    .|:.||              .|||..:|.|||.....|.:.|.....||
 Worm   667 QIF-------YW----SVITLV--------------FLNTCCVASEHYGQPQWFTDFLKYAEFVF 706

Human   808 TGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLVELGLANVE----GLSVLRSFRLLRVFK 868
            .|||..||.||:.||....||...:|.||..::..|..|:..|.|.    |:||:|:.||||:||
 Worm   707 LGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFK 771

Human   869 LAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCKIASDCQLPRWH 933
            |...|.:|..|::.:.||:.::.:|..:|.:.:.|||::||||||..:           ..|..|
 Worm   772 LTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRF-----------NFPTMH 825

Human   934 MNDFFHSF----LIVFRVLCGE-WIETMWDCMEVAGQAMC----LTVFMMVMVI-GNLVVLNLFL 988
            ....|.:|    :.||::|.|| |.|.|:..:|..|....    .:::.:|:|: ||..:||:||
 Worm   826 PYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFL 890

Human   989 ALLLSSF-SADNLAATDDDNEMNNLQIAVDRMHKGVAYVKRKIYEFIQQSFIRKQKILDEIKPLD 1052
            |:.:.:. :|..|.|.::.:|..|                               :|.:|.:.||
 Worm   891 AIAVDNLANAQELTAAEEADEKAN-------------------------------EIEEESEELD 924

Human  1053 DLNNKKDSCMSNHTAEIGKDLDYLKDVNGTTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPI 1117
            :...:.|.|..              |:.|.|:|               |.              .
 Worm   925 EQYQEGDHCTI--------------DMEGKTAG---------------DM--------------C 946

Human  1118 AVGESDFENLNTEDFSSESDLEESKEKLNESSSSSEGSTVDIGAPVEEQPVVEPEETLEPEACFT 1182
            ||..:      .:|...|.:.|||                ..|.|   :|:| |..::       
 Worm   947 AVARA------MDDLDEECEEEES----------------PFGGP---KPMV-PYSSM------- 978

Human  1183 EGCVQRFKCCQINVEEGRGKQWWNLRRTCFRIVEHN-----WFETFIVFMILLSSGALAFEDIYI 1242
                  |.....|.               ||::.|:     :||..::.:|.|||.:||.|| .:
 Worm   979 ------FFLSPTNP---------------FRVLIHSIVCTKYFEMMVMTVICLSSVSLAAED-PV 1021

Human  1243 DQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGY----QTYFTNAWCWLDFLIVDVSLVSL---- 1299
            |:......:|:|.|..||.:|..|||||.:..|.    .:|..:.|..||.::|..:|.:.    
 Worm  1022 DEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAG 1086

Human  1300 TANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIM 1364
            |..:.| ..|..|||||.||.||||:.:.|...::.|.:.::.::.::.|:|:|..:|..||:::
 Worm  1087 TEGSAG-KNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVI 1150

Human  1365 GVNLFAGKFYHC-------INTTTGDRFDIEDVNNHTDCLKLIERNETARWKNVKVNFDNVGFGY 1422
            .|.||.|||:.|       .||..|..|..::.|:.       .|.|...|:....|:||.....
 Worm  1151 AVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDP-------PRVEQREWRLRPFNYDNTINAM 1208

Human  1423 LSLLQVATFKGWMDIMYAAVDSRNVELQP----KYEESLYMYLYFVIFIIFGSFFTLNLFIGVII 1483
            |:|..|.|.:||..|...::|:...:..|    :.|.:|:..::|::|    .||.:|:|:.:||
 Worm  1209 LTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVF----PFFFVNIFVALII 1269

Human  1484 DNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKP-IPRPGNKFQGMVFDFVTRQVFDISI 1547
            ..|.:|    |..::...:..|.....:....:.:|:.. :|...|..:..::..||...|:..|
 Worm  1270 ITFQEQ----GEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFI 1330

Human  1548 MILICLNMVTMMVETDDQSEYVTTILSRINLVFIVLFTGECVLKLIS--LRHYYFTIGWNIFDFV 1610
            |.:||.|.:.:|::..:...:...||...|.....:||.|.:||:::  :|: ||..|||.||||
 Worm  1331 MTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRN-YFRDGWNRFDFV 1394

Human  1611 VVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGL 1675
            .|:.||....:.| ...:|||   ...:||.|..|::||::....||.||:..:.|..||..:.|
 Worm  1395 TVVGSITDALVTE-FGGHFVS---LGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCL 1455

Human  1676 LLFLVMFIYAIFGMSNFA--YVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKP 1738
            |:.::.|||||.||..|.  ::.....|:...||::|.|::|.||:..|..||..::...:..| 
 Worm  1456 LIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGK- 1519

Human  1739 PDCDPNKVNPGSS----VKGD-CGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAE 1798
             ||    ...||:    .||. ||: :|...:|.|::.:|..:::|:::|||::||...|.:|: 
 Worm  1520 -DC----ARAGSAEINFEKGQTCGS-NVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSS- 1577

Human  1799 PLSEDDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQ--PNKL---QLIAMDLPMVS 1858
            .|.....:.|..||..:||.||..:.:.::.:....:.||:...:  |.:|   .||.|::|:..
 Worm  1578 ILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAE 1642

Human  1859 GDRIHCLDILFAFTKRVLGESGEMDALRIQM---EERFMASNPSKVSYQPITTTLKRKQEEVSAV 1920
            ...:|....|||..:         ::|.|:|   ||...|....:::.:.| ..||.|:..|..|
 Worm  1643 DGTVHFTTTLFALIR---------ESLSIKMRPVEEMDEADEELRLTLKKI-WPLKAKKNMVDLV 1697

Human  1921 I------------IQRAYRRHLL---KRTVKQASFTYNKNKIKGGANLLIKEDMIIDRINENSIT 1970
            :            :.:.|...|:   .|..|..:....:....||...|:    ...:..|:..:
 Worm  1698 VPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLV----AAAKAAESQHS 1758

Human  1971 EKTDLTMSTAACPPSYDRVTKPIVEKHEQE 2000
            ..|          |.....|.||:.:|.|:
 Worm  1759 SHT----------PQPPEETTPIIPQHAQQ 1778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 102/371 (27%)
Ion_trans 127..433 CDD:306908 91/332 (27%)
Na_trans_cytopl 510..705 CDD:314757 20/195 (10%)
II. {ECO:0000305} 750..1022 89/287 (31%)
Ion_trans 767..980 CDD:306908 73/227 (32%)
Na_trans_assoc 1006..1213 CDD:310839 28/207 (14%)
III. {ECO:0000305} 1200..1514 95/338 (28%)
Ion_trans 1217..1492 CDD:306908 91/299 (30%)
Na_channel_gate 1484..1536 CDD:240441 7/53 (13%)
IV. {ECO:0000305} 1523..1821 99/307 (32%)
Ion_trans 1540..1796 CDD:306908 86/265 (32%)
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571 0/10 (0%)
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636 4/17 (24%)
GPHH 1800..1863 CDD:318993 16/68 (24%)
unc-2NP_001355464.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.