DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and egl-19

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:NP_001023079.1 Gene:egl-19 / 177513 WormBaseID:WBGene00001187 Length:1877 Species:Caenorhabditis elegans

Alignment Length:1930 Identity:460/1931 (24%)
Similarity:778/1931 (40%) Gaps:565/1931 (29%)


Human   107 ALYILTPFNPLRKIAIKILVHSLFSMLIMCTILTNCVFMTMSNP-----PDWTKN-----VEYTF 161
            :|..|:..||:||:.|.|:....|..||:..|..||:.:.:..|     .|: ||     :||.|
 Worm    67 SLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDY-KNTLLETIEYVF 130

Human   162 TGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVITFAYVTEF-----VDLGNVSALRTFRVL 221
            ..::|.|.::||:|.||......:||:.||.|||.::....|:..     :...:|.|||.||||
 Worm   131 IVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVL 195

Human   222 RALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCIQWPPTNAS 286
            |.|:.:|.:|.|:.::.|:::::..|..:.:|.:|.:.::|:|||:||.|.|.:.||.  |....
 Worm   196 RPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCID--PATGQ 258

Human   287 LEEHSIEKNITVNYNGTLINETVFEFDWKSYIQDSRYHYFLEGFLDALLCGNSSD--AGQCPEGY 349
            |.:.                                         |...||..::  |.:|....
 Worm   259 LAQK-----------------------------------------DPTPCGTDTEGSAFKCQPSD 282

Human   350 MCVKAG-----------RNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTY-MIF 402
            .....|           ..||.|.|:||.|..|.|::|:.::.:.|.::......|.|:.: .|:
 Worm   283 SLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIY 347

Human   403 FVLVIFLGSFYLINLILAVVAMAY-EEQNQATLEEAEQKEAEFQQMIEQLKKQQEAAQQAATATA 466
            ||.::.||||:::||:|.|::..: :|:.:|......||..|.||:.|.||...:...||     
 Worm   348 FVTLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLEEDLKGYLDWITQA----- 407

Human   467 SEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFQKSESEDSIRR 531
              ...||.                                     .|::.|||            
 Worm   408 --EDIEPV-------------------------------------NEDEQEDE------------ 421

Human   532 KGFRFSIEGNRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHS 596
                                |....:                          ||.|   ||:|  
 Worm   422 --------------------PVAQTV--------------------------VGEE---ADEE-- 435

Human   597 TFEDNESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGGPSVPT 661
                              ||.|..::..:..::||                              
 Worm   436 ------------------GEERVEDVRPSKWAARM------------------------------ 452

Human   662 SPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILTNTVEE 726
                                                                           :.
 Worm   453 ---------------------------------------------------------------KR 454

Human   727 LEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYP 791
            ||:..::|.....:     |:...:.|||                  :.:.::||||.:..|||.
 Worm   455 LEKLNRRCRRACRR-----LVKSQTFYWL------------------VILLVLLNTLVLTSEHYG 496

Human   792 MTDHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLVELGLANVE--- 853
            .::..::..|:.||.|..:|:.||.||:.::....|....:|.||.|:|..|::|..|...:   
 Worm   497 QSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMK 561

Human   854 --GLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSY 916
              |:|||||.||||:||:.|.|.:|..|:..:.||:.::.:|.|:|.:.:.|||::|||:||..:
 Worm   562 PLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKF 626

Human   917 KDCVCKIASDCQLPRWHMNDFFHSFLIVFRVLCGE-WIETMWDCME------VAGQAMCLTVFMM 974
                 ........||.:.:.|..:.|.||::|.|| |...|:..:|      ..|..:|: .:::
 Worm   627 -----NFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVCI-YYIV 685

Human   975 VMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHKGVAYVKRKIYEFIQQSFI 1039
            :.:.||.::||:|||:     :.||||..|                                   
 Worm   686 LFICGNYILLNVFLAI-----AVDNLADAD----------------------------------- 710

Human  1040 RKQKILDEIKPLDDLNNKKDSCMSNHTAEIGKDLDYLKDVNGTTSGIGTGSSVEKYIIDESDYMS 1104
                                                                             
 Worm   711 ----------------------------------------------------------------- 710

Human  1105 FINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLNESSSSSEGSTVDIGAPVEEQPVV 1169
                 |||               |.|....:.::|...|:..|.....|...:|.....||....
 Worm   711 -----SLT---------------NAEKEEEQQEIEGEDEEFEEGEDEGEEHGMDEPEGDEEMTSA 755

Human  1170 EPEETLEPEACFTEGCVQR----FKCCQINVEEGRGKQWWNLRRTCFRIVEHNWFETFIVFMILL 1230
            .|....|..|..|...:.:    |.....|          :.|..|..:|.|::|...::|.||:
 Worm   756 RPRRMSEVPAASTVKPIPKASSLFILSHTN----------SFRVFCNMVVNHSYFTNAVLFCILV 810

Human  1231 SSGALAFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGY----QTYFTNAWCWLDFLI 1291
            ||..||.|| .:....|...:|.|.|..||.:|.:|:.||.:.:|.    .::..||:..||.|:
 Worm   811 SSAMLAAED-PLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILV 874

Human  1292 VDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLI 1356
            |   .||||:..|....:..:|.||.||.||||||::|.:|::.||..::.|:.:|.|::||..:
 Worm   875 V---AVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFM 936

Human  1357 FWLIFSIMGVNLFAGKFYHCINTT-------TGDRFDIEDVNNHTDCLKLIERNETARWKNVKVN 1414
            ...:|:|:||.||.|.|:.|.:.:       .|:....||    .|..|.:.:...  |.|...|
 Worm   937 LQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYED----GDPTKPVSKKRV--WSNNDFN 995

Human  1415 FDNVGFGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFI 1479
            |||||...:||..|:||:||..::|.|:||...:..|.:.....:.|:|:.|||..:||.:|:|:
 Worm   996 FDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFV 1060

Human  1480 GVIIDNF-NQQKKKFGGQDIFMTEEQKKYYN-AMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQV 1542
            |.:|..| |:.::::  ::..:.:.|:|... |:|   :|..::.|||  |:.|..|:.|||.:.
 Worm  1061 GFVIVTFQNEGEREY--ENCELDKNQRKCIEFALK---AKPHRRYIPR--NRLQYRVWWFVTSRA 1118

Human  1543 FDISIMILICLNMVTMMVETDDQSEYVTTILSRINLVFIVLFTGECVLKLISLR-HYYFTIGWNI 1606
            |:..|.::|.:|.|::..:....|......|...||:|..:|..|.|||:::|. ..|.:..||:
 Worm  1119 FEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNV 1183

Human  1607 FDFVVVILSIVGMFLAELIE--KYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPA 1669
            ||.:||:.|.:.:...:|..  ...:|...|   ||.|:.|:::|:...:||||||:..|.|..|
 Worm  1184 FDLLVVVGSFIDITYGKLNPGGTNLISINFF---RLFRVMRLVKLLSRGEGIRTLLWTFMKSFQA 1245

Human  1670 LFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMF------NFETFGNSMICLFQITTSAGWDG 1728
            |..:.||:.|:.||||:.||..|.    :|.:||..      ||.:|..:::.||:..|...|..
 Worm  1246 LPYVALLIVLLFFIYAVIGMQFFG----KVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQD 1306

Human  1729 LLAPILNSKPPDCDP--NKVNPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSV 1791
            ::....:.:...|||  :..:.|...:..||| :....:|:|:.::...:|:|:::|||::||..
 Worm  1307 IMLSCSDREDVRCDPMSDDYHKGGLNESRCGN-NFAYPYFISFFMLCSFLVINLFVAVIMDNFDY 1370

Human  1792 ATEESAEPLSEDDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQ--PNKL---QLIA 1851
            .|.:.: .|.....|.|..:|.::||||...::...:......:.|||...:  |::|   :|::
 Worm  1371 LTRDWS-ILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVS 1434

Human  1852 MDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYQPITTTLKR---- 1912
            |::|:.|...:.....|||..:         ..|:|..|.....:|      :.:.:.:||    
 Worm  1435 MNMPLNSDGTVCFNATLFALVR---------TNLKIYTEGNIDEAN------EQLRSAIKRIWKR 1484

Human  1913 --------------KQEEVS-----AVIIQRAYRRHLLKRTVKQA 1938
                          |:::|:     |..:.:.|.|...||...:|
 Worm  1485 THKDLLDEVVPPAGKEDDVTVGKFYATFLIQDYFRRFKKRKEMEA 1529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 104/374 (28%)
Ion_trans 127..433 CDD:306908 89/336 (26%)
Na_trans_cytopl 510..705 CDD:314757 16/195 (8%)
II. {ECO:0000305} 750..1022 83/284 (29%)
Ion_trans 767..980 CDD:306908 69/225 (31%)
Na_trans_assoc 1006..1213 CDD:310839 20/211 (9%)
III. {ECO:0000305} 1200..1514 107/327 (33%)
Ion_trans 1217..1492 CDD:306908 100/287 (35%)
Na_channel_gate 1484..1536 CDD:240441 13/54 (24%)
IV. {ECO:0000305} 1523..1821 96/309 (31%)
Ion_trans 1540..1796 CDD:306908 79/267 (30%)
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571 1/10 (10%)
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636 3/19 (16%)
GPHH 1800..1863 CDD:318993 17/68 (25%)
egl-19NP_001023079.1 Ion_trans 105..379 CDD:278921 83/318 (26%)
Ion_trans 493..714 CDD:278921 79/352 (22%)
Ion_trans 815..1074 CDD:278921 93/269 (35%)
Ion_trans 1134..1376 CDD:278921 74/250 (30%)
GPHH 1384..1447 CDD:293510 16/63 (25%)
Ca_chan_IQ 1449..1521 CDD:285917 14/87 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.