DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and unc-77

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:NP_001293824.1 Gene:unc-77 / 177379 WormBaseID:WBGene00006809 Length:1867 Species:Caenorhabditis elegans

Alignment Length:1997 Identity:378/1998 (19%)
Similarity:717/1998 (36%) Gaps:629/1998 (31%)


Human   130 FSMLIMCTI--LTNCVF----MTMSNPPDW-TKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLR 187
            :::.|.|||  :|.|:.    :.:..|.:: ....::....|:..:|:::|...|....|.::|.
 Worm    88 WALKIACTISMITVCIHTPRTIELFQPLNYIILAADFISVSIFMLDSVLRIHYEGIFRCDSSYLS 152

Human   188 DPW----------NWLDFTVITFAYVTEFVDL---------GNVSALRTFRVLRALKTISVIPGL 233
            :.|          :.|.|.:..:..:..|...         |.:.::|.|.::|.:..:......
 Worm   153 NRWSQFSVFISIIHLLSFLLHCYQLIDNFFPFLHLNYRAWYGAIRSIRPFIIIRLIPLVVKFKLP 217

Human   234 KTIVGALI-QSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCIQWPPTNASLEEHSIEKNIT 297
            |..:..|: :|.:::.:|.:..||.::::|:.|:||| |.:...|:| |.|:.:        |:|
 Worm   218 KNRIEQLLKRSSQQVKNVTLFFVFFMTLYAIFGIQLF-GRMDYHCVQ-PKTDPN--------NVT 272

Human   298 VNYNGTLINETVFEFDWKSYIQDSRYHYFLEGFLDALLCGNSSDAG-QCPEGYMCVKAGRNPN-- 359
            :                            ::..:...:|......| :||...:|::...|..  
 Worm   273 I----------------------------MDLAIPDTMCAPEGIGGYECPAPMVCMQLNLNAKGE 309

Human   360 --YGYTSFDTFSWAFLSLFRLMTQDFWEN-LYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAV 421
              ||  .|:.|..:..:::...:::.|.. ||............::|..:||..::.:.|:.:||
 Worm   310 GFYG--MFNDFGASVFTVYLAASEEGWVYVLYDCMDSLPSYLAFLYFCTLIFFLAWLVKNVFIAV 372

Human   422 VAMAYEEQNQATLEEAEQKEAEFQQMIEQLKKQQEAAQQAATATASEHSREPSAAGRLSDSSSEA 486
            :...:.|           ...:|.:|.:  ||:         .|..|..|:              
 Worm   373 ITETFAE-----------IRVQFSEMWQ--KKE---------VTLDEGFRK-------------- 401

Human   487 SKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFQKSESEDSIRRKGFRFSIEGNRLTYEKRYSS 551
             ||                        ||.:|              |:|..    ||..|.....
 Worm   402 -KL------------------------EKTDD--------------GWRLI----RLDGEVEPEG 423

Human   552 PHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFEDNESRRDSLFVPRRHGE 616
            |.|.|..:..|::       ...|..                   .|....:..:::|| .||.|
 Worm   424 PKQKLQWMLRSMY-------FQCFVI-------------------IFVVINAIGNAMFV-YRHDE 461

Human   617 RRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGGPSVPTSPVGQLLPEVIIDKPATDDN 681
                                                                    .|||     
 Worm   462 --------------------------------------------------------TDKP----- 465

Human   682 GTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILTNTVEELEESRQKCPPCWYKFSNIFL 746
                    ||.....|.|..                :||.| ||                     
 Worm   466 --------RKYNFYLFEVGF----------------TILFN-VE--------------------- 484

Human   747 IWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTDHFNNVLTVG--NLVFTG 809
                                          ||:                  .:|..|  |.:..|
 Worm   485 ------------------------------CII------------------KILCYGFRNFIRRG 501

Human   810 IFTAEMFLKI-IAMDPYYYFQEGWNIFDGFIVTLSLVELGLANVEGLSVLRSFRLLRVFKLAKSW 873
            ||..|:.|.: .:::...:|.|. |.|..|                    ::|||||   |.|:.
 Worm   502 IFKFELILCLGSSLNCVKFFYER-NYFTYF--------------------QTFRLLR---LIKAS 542

Human   874 PTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCKIASDCQLPR-WHMNDF 937
            |.|...:..|.:....||.|.:.....:..::.:.:|||              ..:|. .|...|
 Worm   543 PILEDFVWKIFSPGKKLGGLVIFTIAFICCYSAISLQLF--------------YSVPNLHHFRTF 593

Human   938 FHSFLIVFRVLCGE-WIETMWDCMEVAGQAMCLTV---FMMVMVIGNLVVLNLFLALLLSSFSAD 998
            ..:|:.:|:::..| |.:.:.:.:......:...|   |:...:...|:||:||:|::|     |
 Worm   594 PQAFMSMFQIITQEGWTDFVVEVLRATDDNLVPLVALYFVAYHLFVTLIVLSLFVAVIL-----D 653

Human   999 NLAATDDDNEMNNLQI--AVDRMHKGVAYVKRKIYEFIQQSFIRKQKILDEIKPLDDLNNK-KDS 1060
            ||...::..::..|:.  |...|...:.:..|...:|..:..:...:..|...|:..:... ...
 Worm   654 NLEMDEELKKVKQLRAREATTSMRSTLPWRLRVFEKFPTRPQMAAMRKADSDFPMPKVRGSFTHQ 718

Human  1061 CMSNHTAE----IGKDLDYLKDV-----------NGTT-SGIGTGS---SVEKYIIDESD----- 1101
            ...:|:.|    |..|.::.|.:           :|.| ..||:.|   |:.. :::.||     
 Worm   719 FAVDHSLETTDVIESDFEFPKRIMKSAGKRKISKSGLTFRQIGSTSLRCSLNN-LLEMSDRTRQS 782

Human  1102 ---YMSFINN----------------PSLTVT---VPIAVGESDFENLNTE--DFSSESDLEESK 1142
               .:||:.:                .|.::|   :..||....| |:.:|  |.|..||....|
 Worm   783 LSNSLSFLPHFTRSSGSLYPRKDALPKSRSMTGKFLQTAVRNKQF-NMYSENGDLSRPSDSAPKK 846

Human  1143 EKLNESSSSSEGSTVDIGAPVEEQPVVE------PEETLEPEACFTEGCVQRFKCCQINVEEGRG 1201
                   ::.:|. :||.|..:::.:.|      .|:..|....|......          .||.
 Worm   847 -------NAKQGE-IDIRALQQKRQLAEITRNRIEEDMRENHPFFDRPLFL----------VGRA 893

Human  1202 KQWWNLRRTCFRIVEHNWFE-----TFIVFMILLSSGALA---FEDIYIDQRKTIKTM--LEYAD 1256
            .|   ||..|.::| |:.::     |        :.||..   |::|    |..|..|  :::|.
 Worm   894 SQ---LREFCKKMV-HSKYDSQDDGT--------NGGAKTKKRFKEI----RALIGIMPYIDWAM 942

Human  1257 KVFTYIFILEMLLK--WVAYGYQTYFTNAWCWLD--FLIVDVSL---VSLTANALGYS------E 1308
            ...|.:..:.||.:  |...|......|.:..:.  |.::.::.   |.:.||.|.::      :
 Worm   943 ATVTIVSCISMLFESPWPTTGENLVMNNGYLQISDYFFVLSMTFELCVKIIANGLFFTPKAVVRD 1007

Human  1309 LGAIKS--------------------------LRTLRALRPLRALSRFEGMRVVVNALLGAIPSI 1347
            :|.:.:                          |...||:||||..:....:|.||.........|
 Worm  1008 VGGVMNLFIYFTSVIFLAWMPKHVEINSLAQFLMICRAMRPLRIYTLVPHIRRVVLEFFRGFKEI 1072

Human  1348 MNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTTTGDRFD-------------IEDVNNHTDCLK- 1398
            :.|.::.::...||:..||.:..||...|.:.|...|.:             :|.....|:.:. 
 Worm  1073 LLVTILMIVVMFIFASFGVQIVGGKLAACNDPTVSSRENCTGVFWQKLFVTRLEVYGKDTEAMHP 1137

Human  1399 --LIERNETARWKNVK-VNFDNVGFGYLSLLQVATFKGW---MDIMYAAVDSRNVELQPKYEESL 1457
              ::.|    .|.|.: .|||:||...|:|.:..:||||   .||:::             ....
 Worm  1138 KIMVPR----VWTNPRNFNFDHVGNAMLALFETLSFKGWNVIRDILWS-------------RHGP 1185

Human  1458 YMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKP 1522
            :..::..|::..|....|.||:||:|.|:.|.:     ....:|.:|:::::...:|...:|...
 Worm  1186 WAVVFIHIYVFIGCMIGLTLFVGVVIANYTQNR-----GTALLTVDQRRWHDLKARLKMAQPLHV 1245

Human  1523 IPRPGN--KFQGMVFDFVTRQVFDISIMILICLNMVTMMV-----ETDDQSEY---VTTILSRIN 1577
            .|:|..  :.:..::|....:.|:.:..:|:.||..|:::     |.:.::.|   ||.:.:.:|
 Worm  1246 PPKPSESARLRTKLYDLTMSRWFNQAFALLVVLNSFTLVIPWNVEEEEQRATYVFTVTALAAFMN 1310

Human  1578 LVFIVLFTGECVLKLISLRHYYFTIGW----NIFDFVVVILSIVGMFLAELIEKYFVSPTLFRV- 1637
            ::|::    |.:||:|:   |.|:..|    |..|.::.:..::.:||     .:||:....:: 
 Worm  1311 MLFVI----EIILKVIA---YTFSGFWQSRRNRVDLLITVFGVIWIFL-----HFFVALPSSKID 1363

Human  1638 ----IRLAR----------IGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFG 1688
                :.|.:          |.|...:......::.|:..::||:...|.|...|||::..||..|
 Worm  1364 VDVQVELKKFTYTFGYLVVILRFFTIASRNSTLKMLMLTVIMSMFRSFFIITALFLLVLFYAYTG 1428

Human  1689 MSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNKVNPGSSV- 1752
            :..|..||..:.:....||.|...:::.||:..|...|:.::...:.| .|.|   ..|.|.:. 
 Worm  1429 VILFPMVKYGMAVSKHVNFRTASEALVVLFRCLTGEDWNDIMHDCMRS-APFC---YWNEGMNYW 1489

Human  1753 KGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSV--ATEESAEPLSEDDFEMFYEVWEKF 1815
            :.||||....|.:|.|:.:|...:|.|:.:|||:||||:  ::||.| .||..|...|..||...
 Worm  1490 ETDCGNFYGAIIYFCSFYLIITYIVRNLLVAVIMENFSLFYSSEEDA-LLSYADIRNFQYVWNMV 1553

Human  1816 DPDATQFMEFEKLSQFAAALEPPLNL-PQPNKLQLIAMDLPMV---SGDRIHCLDILFAFTKRV- 1875
            |.:..:.:..|::......|:..|.: |:.:::....|...|.   :|:.:...|:|:..:.|. 
 Worm  1554 DQEQKRTIPVERVKFLLRLLKGRLEVDPEKDRILFKHMCYEMERLHNGEEVSFHDVLYMLSYRSV 1618

Human  1876 -LGESGEMDALRIQMEERFMASNPSKVSYQPITTTLK---RKQEEVS 1918
             :.:|.:::.|..:.|..|:..  .:|:.|.|.|.|:   ||....|
 Worm  1619 DIRKSLQLEELLQREELEFIIE--EEVAKQTIRTWLEGCLRKMRNPS 1663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 63/357 (18%)
Ion_trans 127..433 CDD:306908 59/336 (18%)
Na_trans_cytopl 510..705 CDD:314757 26/195 (13%)
II. {ECO:0000305} 750..1022 53/282 (19%)
Ion_trans 767..980 CDD:306908 40/221 (18%)
Na_trans_assoc 1006..1213 CDD:310839 48/264 (18%)
III. {ECO:0000305} 1200..1514 79/383 (21%)
Ion_trans 1217..1492 CDD:306908 71/344 (21%)
Na_channel_gate 1484..1536 CDD:240441 8/54 (15%)
IV. {ECO:0000305} 1523..1821 83/330 (25%)
Ion_trans 1540..1796 CDD:306908 72/286 (25%)
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571 4/13 (31%)
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636 4/17 (24%)
GPHH 1800..1863 CDD:318993 14/67 (21%)
unc-77NP_001293824.1 Ion_trans 107..383 CDD:278921 53/327 (16%)
Ion_trans 455..660 CDD:278921 67/404 (17%)
Ion_trans 973..1214 CDD:278921 54/258 (21%)
Ion_trans 1310..1534 CDD:278921 62/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.