DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and F17C8.6

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:NP_497974.1 Gene:F17C8.6 / 175626 WormBaseID:WBGene00008911 Length:279 Species:Caenorhabditis elegans

Alignment Length:115 Identity:30/116 (26%)
Similarity:57/116 (49%) Gaps:14/116 (12%)


Human   444 FQQMIEQLKK---QQEAAQQAATATASEHSREPSA--AGRLSDSSSEASKLSSKSAKERRNRRKK 503
            |.|..|.|.|   ..||:.:..:....:.|.:..|  ...:::..:||.|.|.|.|.::.:.|:.
 Worm   157 FPQSQEVLTKGVVLTEASPEEDSLQGDKGSGKKKAQRGNSITEIVAEAQKKSVKRATDKISERRG 221

Human   504 RKQKEQSGG----EEKDEDEFQKSESEDSIRRKGFRFS-IEGNRLTYEKR 548
            ..::.|.|.    ||.:|||    :::..|||..|.:| ::..::::||:
 Worm   222 TLRQMQMGTYDELEEVEEDE----DTDGEIRRSSFEYSGVDMIQMSHEKQ 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 5/13 (38%)
Ion_trans 127..433 CDD:306908
Na_trans_cytopl 510..705 CDD:314757 13/45 (29%)
II. {ECO:0000305} 750..1022
Ion_trans 767..980 CDD:306908
Na_trans_assoc 1006..1213 CDD:310839
III. {ECO:0000305} 1200..1514
Ion_trans 1217..1492 CDD:306908
Na_channel_gate 1484..1536 CDD:240441
IV. {ECO:0000305} 1523..1821
Ion_trans 1540..1796 CDD:306908
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636
GPHH 1800..1863 CDD:318993
F17C8.6NP_497974.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.