DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCN1A and scn1a

DIOPT Version :8

Sequence 1:NP_001159435.1 Gene:SCN1A / 6323 HGNCID:10585 Length:2009 Species:Homo sapiens
Sequence 2:XP_012826731.1 Gene:scn1a / 100488621 XenbaseID:XB-GENE-978019 Length:2020 Species:Xenopus tropicalis

Alignment Length:2028 Identity:1670/2029 (82%)
Similarity:1825/2029 (90%) Gaps:34/2029 (2%)


Human     1 MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPD-KKDDDENGPKPNSDLEAGKNLPFI 64
            |.|..|||||||||.:|:||||.|||:||||||||.||.: :.|||:|||||:|||||||:||||
 Frog     1 MAQARLVPPGPDSFRYFSRESLEAIEKRIAEEKAKKPKQEHRDDDDDNGPKPSSDLEAGKSLPFI 65

Human    65 YGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHSL 129
            ||||||.|||||||||||||:|:|||||||:||||||||||||||||||||||||:|||:|||||
 Frog    66 YGDIPPGMVSEPLEDLDPYYMNQKTFIVLNRGKAIFRFSATSALYILTPFNPLRKVAIKVLVHSL 130

Human   130 FSMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLD 194
            ||||||||||||||||||||||:|||||||||||||||||||||:|||||||.||||||||||||
 Frog   131 FSMLIMCTILTNCVFMTMSNPPEWTKNVEYTFTGIYTFESLIKILARGFCLEKFTFLRDPWNWLD 195

Human   195 FTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLS 259
            |:||..|||||||:|||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   196 FSVIVMAYVTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLS 260

Human   260 VFALIGLQLFMGNLRNKCIQWPPTNASLEEHSIEKNITVNYNGTLI------NETVFEFDWKSYI 318
            ||||||||||||:|||||:||||.     ::....||....|||:.      |.|...|||:.||
 Frog   261 VFALIGLQLFMGHLRNKCLQWPPI-----DYFPLTNIPPILNGTMNIHDPFGNTTNSTFDWEEYI 320

Human   319 QDSRYHYFLEGFLDALLCGNSSDAGQCPEGYMCVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDF 383
            .|..:.|.|||..|.||||||||:||||:||:|||.|:||||||||||||||||||||||||||:
 Frog   321 TDKNHFYKLEGQKDFLLCGNSSDSGQCPKGYICVKTGKNPNYGYTSFDTFSWAFLSLFRLMTQDY 385

Human   384 WENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQMI 448
            |||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||:
 Frog   386 WENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFQQML 450

Human   449 EQLKKQQEAAQQAATAT---ASEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQS 510
            ||||||||.||.||.|.   :.|:| |....|.||:||||||||||||||:||||:|||||||..
 Frog   451 EQLKKQQEEAQAAAVAALNMSREYS-EDGGFGPLSESSSEASKLSSKSAKDRRNRKKKRKQKELG 514

Human   511 GGEEKDEDE-FQKSESEDSIRRKGFRFSIEGNRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSL 574
            ...||.:|| |.|||||.||:||||||||||||||||.::||||||||||||||||||||||.||
 Frog   515 EEYEKGDDEKFPKSESETSIKRKGFRFSIEGNRLTYENKFSSPHQSLLSIRGSLFSPRRNSRASL 579

Human   575 FSFRGRAKDVGSENDFADDEHSTFEDNESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANG 639
            ||||.||||||||||||||||||||||||||.|||||.|||||||||:||.|:||:.:.|.||||
 Frog   580 FSFRNRAKDVGSENDFADDEHSTFEDNESRRGSLFVPNRHGERRNSNISQVSKSSKTMTVLPANG 644

Human   640 KMHSTVDCNGVVSLVGGPSVPTSPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFL 704
            ||||||||||||||:|||||||||||.||||||:||||:||||||||||:|||:||.:.|.||.|
 Frog   645 KMHSTVDCNGVVSLLGGPSVPTSPVGLLLPEVIVDKPASDDNGTTTETEIRKRKSSCYQVPMDLL 709

Human   705 EDPSQRQRAMSIASILTNTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHVVNLVVMDPF 769
            |||:.||||:|:|||||||||||||||||||||||||:|.||||||...||.|||:|.|:|||||
 Frog   710 EDPTARQRALSVASILTNTVEELEESRQKCPPCWYKFANTFLIWDCCENWLTVKHIVKLIVMDPF 774

Human   770 VDLAITICIVLNTLFMAMEHYPMTDHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNI 834
            ||||||||||||||||||||||||..||:||::|||||||||||||..|:||:||||||||||||
 Frog   775 VDLAITICIVLNTLFMAMEHYPMTKEFNDVLSIGNLVFTGIFTAEMVFKLIALDPYYYFQEGWNI 839

Human   835 FDGFIVTLSLVELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAI 899
            |||.||:|||:||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog   840 FDGIIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAI 904

Human   900 IVFIFAVVGMQLFGKSYKDCVCKIASDCQLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAG 964
            ||||||||||||||||||:||||||.:|:||||||||||||||||||||||||||||||||||||
 Frog   905 IVFIFAVVGMQLFGKSYKECVCKIAENCELPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAG 969

Human   965 QAMCLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHKGVAYVKRK 1029
            |:|||.|||:||||||||||||||||||||||:|||.|||||||||||||||.|:.:|:.|||:.
 Frog   970 QSMCLLVFMLVMVIGNLVVLNLFLALLLSSFSSDNLTATDDDNEMNNLQIAVGRIQRGIDYVKKT 1034

Human  1030 IYEFIQQSFIRKQKILDEIKPLDDLNNKKDSCMSNHTA-EIGKDLDYLKDVNGTTSGIGTGSSVE 1093
            |.|.||::|::|||.|||||||::|:||::||:.||.| ||.|.|||.|..||||||:  |||||
 Frog  1035 IRECIQKAFVKKQKGLDEIKPLEELHNKRESCLFNHNAVEINKVLDYHKGDNGTTSGV--GSSVE 1097

Human  1094 KYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLNESSSSSEGSTVD 1158
            ||||||:||||||:||||||||||||||||||||||||||||||||||||||| .:|||||||||
 Frog  1098 KYIIDENDYMSFIHNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLN-MTSSSEGSTVD 1161

Human  1159 IGAP-----VEEQPV-VEPEETLEPEACFTEGCVQRFKCCQINVEEGRGKQWWNLRRTCFRIVEH 1217
            |..|     .|.:|: :|.||.|||:||||||||:||..|.:|:||.:||.||..|:||:.||||
 Frog  1162 IRPPGVVAEGEGEPIDIESEEALEPDACFTEGCVKRFPICYVNIEENKGKLWWTFRKTCYTIVEH 1226

Human  1218 NWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGYQTYFTN 1282
            |||||||:|||||||||||||||||:||||||||||||||||||||||||||||||||:..||||
 Frog  1227 NWFETFIIFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFVKYFTN 1291

Human  1283 AWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSI 1347
            |||||||||||||||||.||||||||||||||||||||||||||||||||||||||||:||||||
 Frog  1292 AWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSI 1356

Human  1348 MNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTTTGDRFDIEDVNNHTDCLKLIERNETARWKNVK 1412
            |||||||||||||||||||||||||:|||:|||||:......|||.:|||.|   ||:|||||||
 Frog  1357 MNVLLVCLIFWLIFSIMGVNLFAGKYYHCVNTTTGEMLLDTQVNNRSDCLHL---NESARWKNVK 1418

Human  1413 VNFDNVGFGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNL 1477
            |||||||.|||:|||||||||||||||||||||.||.||:||::|||||||||||||||||||||
 Frog  1419 VNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRKVEEQPRYEDNLYMYLYFVIFIIFGSFFTLNL 1483

Human  1478 FIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQV 1542
            |||||||||||||||||||||||||||||||||||||||||||||||||.||:||:||||||:|.
 Frog  1484 FIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPPNKYQGLVFDFVTKQA 1548

Human  1543 FDISIMILICLNMVTMMVETDDQSEYVTTILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIF 1607
            |||.|||||||||||||:|||:||:.:...|..||||||:||||||:||:|||||||||||||||
 Frog  1549 FDIIIMILICLNMVTMMIETDEQSQDMENNLYWINLVFIILFTGECILKIISLRHYYFTIGWNIF 1613

Human  1608 DFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFN 1672
            |||||||||||||||::||||||||||||||||||||||||||||||||||||||||||||||||
 Frog  1614 DFVVVILSIVGMFLADMIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFN 1678

Human  1673 IGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSK 1737
            ||||||||||||||||||||||||:|.|||||||||||||||||||||||||||||||||||||.
 Frog  1679 IGLLLFLVMFIYAIFGMSNFAYVKKESGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSG 1743

Human  1738 PPDCDPNKVNPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSE 1802
            .|||||...:|||||||||||||||||||||||||||||||||||||||||||||||||||||.|
 Frog  1744 APDCDPQMEHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLGE 1808

Human  1803 DDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGDRIHCLDI 1867
            ||||||||||||||||||||:|:.|||.||.||:|||.:.:||::||||||||||||||||||||
 Frog  1809 DDFEMFYEVWEKFDPDATQFIEYSKLSNFADALDPPLRIAKPNRVQLIAMDLPMVSGDRIHCLDI 1873

Human  1868 LFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAVIIQRAYRRHLLK 1932
            |||||||||||..||||||:.||||||||||||.||:|||:||:|||||:|.|||||.:|::||:
 Frog  1874 LFAFTKRVLGEGDEMDALRLPMEERFMASNPSKASYEPITSTLRRKQEELSVVIIQRCFRKYLLR 1938

Human  1933 RTVKQASFTYNKNKIKGGANLL-IKEDMIIDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEK 1996
            :|:|:||:.|.|.|:  |.|.| |||||:||::|.||.|||||:|.||.: |||||.||||..||
 Frog  1939 KTIKKASYLYKKEKL--GVNSLPIKEDMVIDKLNGNSTTEKTDMTPSTTS-PPSYDSVTKPEKEK 2000

Human  1997 HEQEGKDEKAKGK 2009
            ||::..:::.|.|
 Frog  2001 HEKDKAEKENKSK 2013

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCN1ANP_001159435.1 I. {ECO:0000305} 110..454 292/350 (83%)
Ion_trans 127..433 CDD:306908 257/312 (82%)
Na_trans_cytopl 510..705 CDD:314757 160/196 (82%)
II. {ECO:0000305} 750..1022 240/272 (88%)
Ion_trans 767..980 CDD:306908 194/213 (91%)
Na_trans_assoc 1006..1213 CDD:310839 148/214 (69%)
III. {ECO:0000305} 1200..1514 277/314 (88%)
Ion_trans 1217..1492 CDD:306908 245/275 (89%)
Na_channel_gate 1484..1536 CDD:240441 49/52 (94%)
IV. {ECO:0000305} 1523..1821 268/298 (90%)
Ion_trans 1540..1796 CDD:306908 230/256 (90%)
S1-S2 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1561..1571 5/10 (50%)
S3b-S4 loop of repeat IV. {ECO:0000250|UniProtKB:A2APX8} 1619..1636 15/17 (88%)
GPHH 1800..1863 CDD:318993 50/63 (79%)
scn1aXP_012826731.1 Ion_trans 150..435 CDD:278921 235/290 (81%)
Na_trans_cytopl 512..631 CDD:288761 99/119 (83%)
Ion_trans 790..985 CDD:278921 176/195 (90%)
Na_trans_assoc 1011..1222 CDD:284034 148/214 (69%)
Ion_trans 1244..1498 CDD:278921 228/257 (89%)
Na_channel_gate 1490..1542 CDD:240441 49/52 (94%)
Ion_trans 1564..1802 CDD:278921 215/238 (90%)
GPHH 1814..1869 CDD:293510 43/55 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2301
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D10241at32523
OrthoFinder 1 1.000 FOG0000322
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.