DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ELOVL5 and CG31523

Sequence 1:NP_001229757.1 Gene:ELOVL5 HGNCID:21308 Length:326 Species:Homo sapiens
Sequence 2:NP_001262255.1 Gene:CG31523 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster

Alignment Length:296 Identity:106/297 (36%)
Similarity:155/297 (52%) Gaps:39/297 (13%)


Human    20 DTRVKGWFLLDNYIPTFICSVIYLLI-VWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCES 83
            |.||..:|||.:.:||....:.|... ..|||:.|..::|...|.:|||||...|:.|.::|.| 
  Fly    21 DPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYE- 84

Human    84 KREQPRRSACASRTDPSTQQQLPENRLVTGVWEGKYNFFCQGT--RTAGESDMKIIRVLWWYYFS 146
                                     .|::| |.|.|:..||..  .|.|.: |:::.:.||||.|
  Fly    85 -------------------------YLMSG-WWGHYSLKCQPVDYSTTGLA-MRMVNICWWYYIS 122

Human   147 KLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYY 211
            |..||.||.||||||.|..::.|||.||..|....|..:.:.|.|||.|.|.||||:|::||.||
  Fly   123 KFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYY 187

Human   212 GLSSV-PSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIG-YMISLIALFT 274
            .:::: |..:.|:|||||:|..|::|||.........:...|.:|.|::.: || :.:..:.||:
  Fly   188 MIAAMGPKYQKYIWWKKYLTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVW-IGLHGVMFLFLFS 251

Human   275 NFYIQTYNKKGASRRKDHLK--DHQNGSMAAVNGHT 308
            :||...| ...|.||:..:|  .:.|||  |.|||:
  Fly   252 DFYKAKY-LNAARRRRQAVKANGYANGS--ASNGHS 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ELOVL5NP_001229757.1 ELO 27..288 CDD:307345 93/266 (35%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 94/267 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094172at2759
OrthoFinder 1 1.000 FOG0000111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.