DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BCL6 and CG31365

Sequence 1:NP_001124317.1 Gene:BCL6 HGNCID:1001 Length:706 Species:Homo sapiens
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:568 Identity:112/569 (20%)
Similarity:187/569 (33%) Gaps:147/569 (26%)


Human   239 PGEYSRPTLEVSPNVCHSNIYSP---------KETIPEEARSDMHYSVAEGLKPAAPSARNAPYF 294
            |.:|....||...::....:...         :|...||..::||..:.:               
  Fly   104 PDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWREDFKEEQAAEMHKRLVK--------------- 153

Human   295 PCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQAS 359
                 |:.|.|.....|:............||.|......|..|...|..:|....:...:|...
  Fly   154 -----SRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSEDIRKEQLAMLLGE 213

Human   360 GSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLD 424
            .....   |:.||..|:.     |:......||:..|.|...|...:|.   |..:|.:...||.
  Fly   214 LEVYL---TEKKAGRWES-----LDGSEPETKPQVKEDASPSRSKTKAL---PKRRPSLVDANLK 267

Human   425 LQSPTKLSASGE----------------------DSTIPQAS----RLNNIVNRSM--------- 454
            .....|.:...|                      |..:|..|    |..|:|...:         
  Fly   268 ATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNGEIY 332

Human   455 ---TGSPRSSSESHSPLYMHPPKCTS-----------CGSQSPQHAEMCLHTAGPTFPEEMGETQ 505
               :.|....::..:|.:......||           .|.:..:..::.:...|    ||:.:.|
  Fly   333 IINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLG----EEISQEQ 393

Human   506 SEYS---------------------------------DSSC---ENG-------AFFCNECDCRF 527
            ..:|                                 :|||   :.|       :|.|:.|...|
  Fly   394 QVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITDTVKSFQCHLCPVAF 458

Human   528 SEEASLKRH------TLQTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRP 586
            ..:..|.||      .|::......||..|........:|..|..:|||.||::|:.|...|::.
  Fly   459 PTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQR 523

Human   587 ANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHV-LIHTG-EKPYPCEICGTRFRHLQTLKSHL 649
            ..||.|...|:|.|.::|..|.:.|.|.::|:.|: .:|.| .:.:.|.:|...|.|:..|..||
  Fly   524 EVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHL 588

Human   650 RIHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATD 697
            ..|.|.. :.|::|...|..:|.::.|:...| .:.|....| :|.|:
  Fly   589 VTHAGVM-FSCKQCGRQFNDRSAVQRHVTTMH-KVKNKLTDY-ISETN 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BCL6NP_001124317.1 BTB 22..126 CDD:279045
BTB 33..126 CDD:197585
Required for interaction with NuRD complex and for transcriptional repressor activity 376..379 0/3 (0%)
C2H2 Zn finger 520..541 CDD:275368 7/27 (26%)
C2H2 Zn finger 548..568 CDD:275368 4/20 (20%)
zf-H2C2_2 560..585 CDD:290200 10/25 (40%)
C2H2 Zn finger 576..596 CDD:275368 6/20 (30%)
zf-H2C2_2 588..613 CDD:290200 9/25 (36%)
C2H2 Zn finger 604..624 CDD:275368 6/21 (29%)
zf-H2C2_2 616..641 CDD:290200 7/27 (26%)
C2H2 Zn finger 632..652 CDD:275368 7/20 (35%)
zf-H2C2_2 645..669 CDD:290200 8/24 (33%)
C2H2 Zn finger 660..678 CDD:275368 5/18 (28%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 27/163 (17%)
RRF <161..222 CDD:294170 10/64 (16%)
zf-C2H2_8 454..530 CDD:292531 22/76 (29%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.