DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zwilch and Zwilch

Sequence 1:NP_733421.1 Gene:Zwilch FlyBaseID:FBgn0061476 Length:641 Species:Drosophila melanogaster
Sequence 2:XP_008764606.1 Gene:Zwilch RGDID:1583880 Length:611 Species:Rattus norvegicus

Alignment Length:748 Identity:144/749 (19%)
Similarity:242/749 (32%) Gaps:272/749 (36%)


  Fly     1 MSASANLANVYAELMRRCGESYTITYGAPPTYLVSMVGAAEAGKKIVLVFKEDRNGAVARLRTTP 65
            ||||..........|.|......:....         .|.|...:::..|.|::.|    :|..|
  Rat     1 MSASGRAVQFSCTAMERSDRGMWVRLNR---------AAEEFYARLLQEFNEEKKG----IRKDP 52

  Fly    66 --------TRAAPKKEGSADLDLTGSPLKDDCLVDAIADLSIDLQLDHSNPWKLEEEYQRGI--- 119
                    .:...||   |..:|..:.|.::.||..:.  .:.|:.:.::..|..:..|..|   
  Rat    53 FIYEADVQVQLVSKK---AQPNLLKTLLNENDLVFLVE--KVVLEKEETSMLKEPQSEQTAISDL 112

  Fly   120 -----------PVDKARSIV------------CSEFLQLAEGLGSVWFLCDGSDLGQTQLLQYEF 161
                       ||.:||.::            ..:..|....|..:|..||.||...|..|..| 
  Rat   113 STGENIRPLALPVGRARQLIGLYTMAHNPNMTHLKIKQPVTALPPLWVRCDSSDPESTCWLGAE- 176

  Fly   162 NPTHFSRGILSYQGVRP---AYLVTSQA---------------LVRHH----------------- 191
                    :::..|...   .|:||.:|               ..|||                 
  Rat   177 --------LITANGAVTDVVLYVVTCKADKNYSENLENLKNLHKKRHHLSAVTARGFAQFELFKS 233

  Fly   192 -----GKTPDETLIENSYQVNPHMRLRCSW------------TSSAALPLLVNLNDCDVALNHTF 239
                 ..||.:|.:          .|..||            :|:|.|.:.|...:....|||..
  Rat   234 TDLDDTVTPSQTTV----------TLDLSWSPVDEILQTPPLSSTATLNIRVQSGEPRGCLNHLH 288

  Fly   240 RVGDCGPLTQDFMNQLRILVYIREDIVSYHTDVKQGVSR--DPTYRCGSGIDMDELRESINQTMT 302
            |             :|:.|:.:.:.|       :.||:.  :|       ::.....||:.:.:.
  Rat   289 R-------------ELKFLLVLADGI-------RTGVTEWLEP-------LETKSAVESVQEFLN 326

  Fly   303 DVSGLIGRYSISNAEFD---IEDVVQRA--------------KVRQLTDLTDKLW-ELLKCCHSY 349
            |::.|        .|||   .:|..:.|              .||...|..::|| ::.....||
  Rat   327 DLNKL--------DEFDDSTKKDTQKEAVNHDTAAVVRSMLVTVRGDLDFAEQLWCKMSSSVVSY 383

  Fly   350 KDLKIAFSMLFQCAARCNIVNT---PTNKNRLAKIITELANRRLAMPCLSGAEPLELLLEIGLEK 411
            :||...|:::.| :.:|..:..   ..:.:.|:|:|.:..:..:....|||..||::||||||:|
  Rat   384 QDLVKCFTLILQ-SLQCGDIQPWLHSGSNSLLSKLIHQSYHAAMDSVPLSGTTPLQMLLEIGLDK 447

  Fly   412 LYKDYEFIYTESKMCSTNLLKDDSSGASMDDGSPQNLPQL--RKSLHNAVRGDPTPGAGMRKTLL 474
            |.|||...:...::.|.|.|:...|            |.:  ::.:|.           :||  |
  Rat   448 LKKDYISFFVSQELASLNHLEYFIS------------PSVTTQEQVHR-----------VRK--L 487

  Fly   475 HH---------------HG---AVNSRSTKYAGSDDDAGFKNSHFDEHESTERISKLFQIHCTLE 521
            ||               |.   ::.....||        :|.:..||                 :
  Rat   488 HHILEILVICMLFIKPQHELLFSLTQSCIKY--------YKQNPLDE-----------------Q 527

  Fly   522 HLLMMHIH-LNLANVYNDVCSELLKKPPKLVESIDDQLSDVMDI-RLSAHYVRDHLDGKDPYSRH 584
            |:..:.:. ..|.|:|..      :||.|....|......|..: :||.....||.....|....
  Rat   528 HIFQLPVRPAALKNLYQS------EKPQKWRVEIGSSQKKVKTVWQLSECSPVDHCSFHKPEFSE 586

  Fly   585 ITMRSHNKFRELKTTFYFNSENICPPNLAQCFQ 617
            :|:   |...|.:..|.         |:..|.|
  Rat   587 LTL---NGSLEERAAFI---------NMVTCSQ 607

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZwilchNP_733421.1 DUF2352 29..638 CDD:286855 138/721 (19%)
ZwilchXP_008764606.1 DUF2352 52..604 CDD:286855 132/683 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C156244308
eggNOG 1 0.900 E1_KOG4803
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1451737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15995
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.