DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zwilch and zwl-1

Sequence 1:NP_733421.1 Gene:Zwilch FlyBaseID:FBgn0061476 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_001249150.1 Gene:zwl-1 WormBaseID:WBGene00021460 Length:630 Species:Caenorhabditis elegans

Alignment Length:476 Identity:88/477 (18%)
Similarity:163/477 (34%) Gaps:130/477 (27%)


  Fly    38 GAAEAGKKIVLVFKEDRNGAVARLRTTPTRAAPKKEGSADLDLT--GSPLKDDCLV------DAI 94
            ||.:|.||  ::||:              :..|.::...|.:..  |.||....|.      ..:
 Worm    76 GAGKAEKK--MIFKK--------------KIEPMEDSFEDKENVNEGGPLMTSFLTLEKLRKGMV 124

  Fly    95 ADLSI-----DLQLDHSNPWKLEEEYQRGIPVDKARSIVCSEFLQLAEGLGSVWFLCDGSDL--- 151
            .|:.|     :.....:||..|.:    |:.:.:...:.|||....:.....||.....|..   
 Worm   125 GDVEIIGYECETSFFDANPIPLSD----GVSLQRYIRLNCSEHFSPSISTLPVWISTTSSKFPSI 185

  Fly   152 -----GQT-QLLQY--------EFNPTHFSR---------GILSYQGVRPAYLVTSQALVRHHGK 193
                 |:| :.:|:        .||..:..|         |.......|..| ...:.:...:..
 Worm   186 CWLAAGRTNRNVQFAAATRVLGHFNNENSERVVKQLNQACGTSQLNKYRAVY-EEIRKIATENRP 249

  Fly   194 TPDETLIENSYQVNPHMRLRCSWTSSAALPLLV---NLNDCDVAL-----NHTFRVGDCGPLTQD 250
            .|.|..|:            ..|::.:.|.||.   |..||.:.:     :..|.|.|      :
 Worm   250 APGEVTID------------VRWSTKSTLVLLEHPDNAADCTIKIDLGWGDKRFFVDD------E 296

  Fly   251 FMNQLRILVYIREDIVSYHTDVKQGVSRDPTYRCGSGIDMDELRESINQTMTDVSGLIGRYSISN 315
            ...||..::.:        .||......:..:......:.|:|.:.:: .:.:.|.......:||
 Worm   297 IFEQLFFVLNL--------ADVLANPDNEVIFPMAPPANFDDLVQEMD-ALVEASSREDNVFVSN 352

  Fly   316 AEFDIEDVVQRAKVRQLTDLTDKLWELLKCCHSYKDLKIAFSMLFQCAARCNIVN--TPTNKNRL 378
            ..|            :..|:|||:|.:::.|:..|.:.:.|....|..|...|.:  ...||:.|
 Worm   353 ENF------------RGGDITDKVWNIVRKCNDVKQVTLLFRNFLQALAYGKIKSHAQERNKSHL 405

  Fly   379 AKIITELANRRLAMPCLSGAEPLELLLEIGLEKLYK---------------DYEFIYTESKMCST 428
            |.:|....:....:|.|.....:::::|||:|.|.:               :.|||.   :.|..
 Worm   406 ASLIRISKSSEFKIPVLERLSTIDMMMEIGVESLRRRVIDIFSSQLLYPSDELEFIL---QTCEN 467

  Fly   429 NLLKDDSSGASMDDGSPQNLP 449
            :|   .:...:|:..:...||
 Worm   468 DL---PAGNGAMNSAAISLLP 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZwilchNP_733421.1 DUF2352 29..638 CDD:286855 88/477 (18%)
zwl-1NP_001249150.1 DUF2352 27..630 CDD:286855 88/477 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C155661976
eggNOG 1 0.900 E1_KOG4803
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15995
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.