DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstD10 and GstD8

Sequence 1:NP_001287302.1 Gene:GstD10 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster

Alignment Length:206 Identity:126/207 (61%)
Similarity:157/207 (76%) Gaps:1/207 (0%)


  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65
            ||.||.|.|||||||:||||||||:.:.| ::.....||..||::|:||||.||||.|.||::||
  Fly     1 MDFYYHPCSAPCRSVIMTAKALGVDLNMK-LLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWE 64

  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLKKPANEENYKK 130
            ||||::|||||||.||.|:|.|.||:|::|||||||||||::||.|..||||....||:.|..:|
  Fly    65 SRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPEAMQK 129

  Fly   131 IEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKRYANVARWYENAKKLTPGWE 195
            ::.||..|:||||.|.|.||...::||||.||:||||:|..||..:|.||||||||||::|||||
  Fly   130 VDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVARWYENAKEVTPGWE 194

  Fly   196 ENWAGCQEFRK 206
            |||.|.|..:|
  Fly   195 ENWDGVQLIKK 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 46/74 (62%)
PLN02473 3..196 CDD:166114 118/193 (61%)
GST_C_Delta_Epsilon 89..205 CDD:198287 70/116 (60%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 115/188 (61%)
GST_N_Delta_Epsilon 1..74 CDD:239343 46/74 (62%)
GST_C_Delta_Epsilon 88..204 CDD:198287 70/116 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131160729
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 1 0.900 OOG5_126942
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.