DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18764 and CG31365

Sequence 1:NP_652712.2 Gene:CG18764 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:626 Identity:126/627 (20%)
Similarity:199/627 (32%) Gaps:237/627 (38%)


  Fly     1 MALQCRTCGSIIYNKMPKNLFHIENEKMLQDINLVTGTTLHNDPE----LPSSICACCTLDLNQA 61
            :|..||.|  :..::....:|..::.::...:.|:....|  |.:    ||..||..|...|.::
  Fly    10 LATLCRLC--LKEHQDAYAIFDEDDTQLSIPVRLMACVAL--DAKATDTLPKRICQECRYQLEKS 70

  Fly    62 ILFRERCILTQKQL--------------------------------------------------- 75
            .|||:||...:|:|                                                   
  Fly    71 FLFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKW 135

  Fly    76 -----------VHRR------------------------RSPEAKEPAEDVEEMASPPDCLNDP- 104
                       :|:|                        ||...||.||:|..... .|..|:. 
  Fly   136 REDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVR-DDLRNEVS 199

  Fly   105 -----------FGEVDEYIVE------------SPE------------------------EVLDH 122
                       .||::.|:.|            .||                        .::|.
  Fly   200 EDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDA 264

  Fly   123 D---SDAHHDLDEDNYI---------DSVEDVDALQDMAEVAEEDSQDVESLISSVQKE------ 169
            :   ::|..|..|:.:|         :|..::|.|:...||..|..:|... |:.|..:      
  Fly   265 NLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFRE-INMVGSDVVHTDN 328

  Fly   170 -----LESICNDDSNSDNNDYMEPQNG--SY-----------------------FN---ETINEY 201
                 :.|..::|.|.|:....:..||  ||                       ||   |...|.
  Fly   329 GEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQ 393

  Fly   202 EVSS---------------NPNTPLPESKSA--------------AGRSTKPATTKPKR----KK 233
            :|.|               :..|||...:|:              .||.|.  |.|..:    ..
  Fly   394 QVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKTGRITD--TVKSFQCHLCPV 456

  Fly   234 QYVTWKNMTEEQIIERKRLQRKR--ECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFY 296
            .:.|.|.:|.......|.|:..:  ...|..|..|.:..|:.|.||:.|||.|.|.|.:|...|.
  Fly   457 AFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFS 521

  Fly   297 TDHLMTLHQRIIHQGEKPYDCRFCTKSF-HNSNTRLIHERTHT-NAKPYSCHHCDKCFKSASGRK 359
            ...::..|.. .|.|.|.:.|..|:..| ..||.:....|.|. |::.:.||.|.:.|...||..
  Fly   522 QREVLKRHMD-THTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLS 585

  Fly   360 RHELIHTGVRAFACTICKQSFQRNTHLKAHLRSKFHTAKAK 400
            ||.:.|.|| .|:|..|.:.|...:.::.|: :..|..|.|
  Fly   586 RHLVTHAGV-MFSCKQCGRQFNDRSAVQRHV-TTMHKVKNK 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 19/75 (25%)
C2H2 Zn finger 260..280 CDD:275368 7/20 (35%)
zf-H2C2_2 272..297 CDD:290200 11/25 (44%)
C2H2 Zn finger 288..309 CDD:275368 4/21 (19%)
C2H2 Zn finger 317..337 CDD:275368 6/21 (29%)
C2H2 Zn finger 345..365 CDD:275368 8/20 (40%)
C2H2 Zn finger 373..391 CDD:275368 4/18 (22%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 20/77 (26%)
vATP-synt_E 109..>244 CDD:304907 17/136 (13%)
RRF <161..222 CDD:294170 13/62 (21%)
zf-C2H2_8 454..530 CDD:292531 21/76 (28%)
C2H2 Zn finger 485..505 CDD:275368 7/20 (35%)
zf-H2C2_2 497..522 CDD:290200 11/25 (44%)
C2H2 Zn finger 513..533 CDD:275368 4/21 (19%)
zf-H2C2_2 526..550 CDD:290200 7/25 (28%)
C2H2 Zn finger 541..562 CDD:275368 6/21 (29%)
C2H2 Zn finger 571..591 CDD:275368 8/20 (40%)
C2H2 Zn finger 598..617 CDD:275368 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.