DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18870 and CG17005

Sequence 1:NP_001286684.1 Gene:CG18870 FlyBaseID:FBgn0042180 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001260287.1 Gene:CG17005 FlyBaseID:FBgn0032109 Length:608 Species:Drosophila melanogaster

Alignment Length:141 Identity:34/142 (24%)
Similarity:55/142 (39%) Gaps:32/142 (23%)


  Fly    38 KLFYTLAKPF--RGDPTVRLEFEDTS---GAIVTQMWNLTLPHGHT------ANKIKYDCQFRVV 91
            |.||.:.:|.  :......|.|...|   |..:..| |||:|....      ...:.|:.:..:|
  Fly   203 KSFYHITQPLWVQNITMSHLSFSFASRDRGLKLLNM-NLTVPRQSVWPLLVDYRPLDYENEAEIV 266

  Fly    92 TSERPRRGIYTI-----ITRLKFRRD-PV-SKECIDYIQFSSGNRSPSERICTDISIDGPAGRLI 149
            .:....:..|.|     :|..|.:.| |: .:||:|::.....||...| ||            :
  Fly   267 LTYENTKARYKIKARGVLTDEKEQTDMPLKDRECVDFLHVIYPNRVNFE-IC------------L 318

  Fly   150 FDQRDRDVNVH 160
            .:.|.:.||||
  Fly   319 REDRTQLVNVH 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18870NP_001286684.1 None
CG17005NP_001260287.1 CDC73_N <443..595 CDD:292669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2E377
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.