DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or19a and LOC1272963

DIOPT Version :10

Sequence 1:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_311894.2 Gene:LOC1272963 / 1272963 VectorBaseID:AGAMI1_014637 Length:77 Species:Anopheles gambiae


Alignment Length:35 Identity:9/35 - (25%)
Similarity:18/35 - (51%) Gaps:4/35 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 PAVRMQAILVGY----IHDHQIILRLFKSLERSLS 256
            ||:|...:|..|    :.::.|..:|.:.|:..:|
Mosquito    35 PALRENIVLSEYPISVVLEYFIFCQLVEKLQDMVS 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 9/35 (26%)
LOC1272963XP_311894.2 None

Return to query results.
Submit another query.