DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp97E

DIOPT Version :8

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster

Alignment Length:195 Identity:46/196 (23%)
Similarity:70/196 (36%) Gaps:55/196 (28%)


  Fly     9 KYLLYLLNLVFVAGGILLIVVG--SIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFVVAFFGC 71
            |..|..||:::|..|.|||.||  :...|.:.|.....|          |:..|.:...::..|.
  Fly     9 KNALIALNILYVMIGFLLIGVGVYARAASIVTNLPIVGG----------ILACGVILICISMLGL 63

  Fly    72 CGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDENNAAQGY---PM 133
            .|.::.:......|.|.:.:||.:|.:            ::|...||:....:..|.||:   |.
  Fly    64 AGAVKHHQVMLFFYMIILFMLFLIQFS------------IASSCLAVNSEQQQQFAEQGWMTVPT 116

  Fly   134 D---ALQLAFSCCG--NTGYQQYETVPSS-----------CCGYKDRTKVCEAEIYSQRPGCRQE 182
            |   .:|.:..|||  .|.......||.|           ||.            :|..|.||.|
  Fly   117 DLRKQVQDSLKCCGFNATAPSTTSVVPPSNEPSCELINQQCCA------------HSSEPDCRCE 169

  Fly   183  182
              Fly   170  169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 46/196 (23%)
tetraspanin_LEL 104..191 CDD:239401 23/99 (23%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 46/196 (23%)
tetraspanin_LEL <121..177 CDD:243179 15/62 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122034249
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.