DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp42El

DIOPT Version :8

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster

Alignment Length:227 Identity:67/228 (29%)
Similarity:100/228 (44%) Gaps:33/228 (14%)


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFV 65
            |.|.:...||.|:|.|.::...|||:::.|.:....|.:..|           |.|:::|....|
  Fly     1 MGCATGTIKYSLFLFNALWAILGILVLIFGGLGWGAMPDAYA-----------IGILILGGTILV 54

  Fly    66 VAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWDENNAAQG 130
            ::.|||||.:||:......||..:|||  |.|.::..|....|.|.....:.|:..|:......|
  Fly    55 ISLFGCCGAVRESPRMLWTYASLLLIL--LLLIVAFIILNPKDVFKKYALQTVENQWELEQTKPG 117

  Fly   131 YPMDALQLAFSCCGNTGYQQY-------ETVPSSCCGYKDRTKVCEAEIYSQRPGC----RQEFV 184
             .||.:|..:.|||....|.|       .|||||||  ||.:.|....:|.:  ||    .:.|.
  Fly   118 -SMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSSCC--KDDSCVNPLNLYVR--GCLIKVEEAFA 177

  Fly   185 DFWASNTDLIRWSSLIIALFELGIFIMSCCLA 216
            | .|:....:.|..|   .|...|.:::..||
  Fly   178 D-EATTLGYLEWGLL---GFNAVILLLAIILA 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 65/221 (29%)
tetraspanin_LEL 104..191 CDD:239401 29/98 (30%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 62/211 (29%)
tetraspanin_LEL 94..178 CDD:239401 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134119478
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.