DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:240 Identity:65/240 - (27%)
Similarity:93/240 - (38%) Gaps:49/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIV----IGS 61
            |.|.|...|..|..||.:....|:.||.:.::.||               ..||..|:    :|.
  Fly     1 MGCTSGCVKCFLNTLNTLNALSGLSLIAIATLALS---------------KAPIAYILFLYGLGG 50

  Fly    62 VTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSM-GKAVDKAWDEN 125
            :.||.|..||||...||.|.|..|...:|....:.| |.|:.|...::::... .:.|...|||.
  Fly    51 IIFVSAVLGCCGICMENVCMTATYGFLLLAQLIISL-LGIFRFKFTEEYIEKFAAEEVQMKWDEE 114

  Fly   126 NAAQGYPMDALQLAFSCCGNTGYQQY-----ETVPSSCCGYKDRTKVCEAEIYSQRP----GCRQ 181
            ....| .||..|..:.|||......|     :|:|.||...:|          .|.|    ||.|
  Fly   115 LVEPG-AMDIYQTVYECCGRDSPDDYVAIGRQTLPPSCYPQED----------PQMPHYLAGCVQ 168

  Fly   182 E----FVDFWASNTDLIRWSSLIIALFELGIFIMSCCLASAMRKR 222
            :    ||..::...| ..|.:|.|.:.   :.|.:..|....||:
  Fly   169 KSSENFVVLFSYAHD-TNWIALGITIL---MMIAAFYLVGRFRKQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 60/228 (26%)
tetraspanin_LEL 104..191 CDD:239401 25/100 (25%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 59/225 (26%)
tetraspanin_LEL 94..174 CDD:239401 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.