DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp42Ee

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster


Alignment Length:231 Identity:76/231 - (32%)
Similarity:124/231 - (53%) Gaps:22/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNCLSAMFKYLLYLLNLVFVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQT-------IPICIIV 58
            |:|.::|.||:|::.|.:....|||.||.|.::|.::|...     ||.|.       :||.:|.
  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVE-----VNGQVGFPIQALMPIILIS 60

  Fly    59 IGSVTFVVAFFGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFLSSMGKAVDKAWD 123
            :||:...::|.||||.|||:.|.|..||..:|||..|||...:.:|...::|.::||..::.||:
  Fly    61 LGSIVVFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLFTHREEFENAMGNVIENAWN 125

  Fly   124 ENNAAQGYPMDALQLAFSCCGNTGYQQY----ETVPSSCCGYKDRTKVCEAEIYSQRPGCRQEFV 184
            ..:..:|...|.:|.:..|||::....|    :.||.|||   ..:.:.....|   ||||.:||
  Fly   126 SEHTYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCC---SGSCLIPTNYY---PGCRGKFV 184

  Fly   185 DFWASNTDLIRWSSLIIALFELGIFIMSCCLASAMR 220
            :...:.:|..::..:.:...||..||.:||||:.:|
  Fly   185 ELMTTGSDNAKYVGIGLIGIELIGFIFACCLANNVR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 72/221 (33%)
tetraspanin_LEL 104..191 CDD:239401 25/90 (28%)
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 72/221 (33%)
tetraspanin_LEL 106..187 CDD:239401 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467680
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.