DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eb and Tsp2A

DIOPT Version :9

Sequence 1:NP_724525.1 Gene:Tsp42Eb / 59177 FlyBaseID:FBgn0042086 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:237 Identity:52/237 - (21%)
Similarity:90/237 - (37%) Gaps:46/237 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYLLYLLNLV--FVAGGILLIVVGSIMLSTMGNFTAFDGGVNTQTIPICIIVIGSVTFV---VAF 68
            ||.|:..|:|  .::..:..:   ::.|.....|..:...:..|:..|.:.|:..::.|   |:|
  Fly    20 KYTLFCFNIVAWMISTALFAL---TVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSF 81

  Fly    69 FGCCGTIRENACCTTIYAICMLILFGLQLALSIWIFAANDKFL---------------SSMGKAV 118
            .||...:.||       .:.:.:..|.|:...|.|.|.:...|               |..|...
  Fly    82 LGCLSALMEN-------TLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVA 139

  Fly   119 DKAWDENNAAQGYPMDALQLAFSCCGNTGYQQY----ETVPSSCCGYKDRTKVCEAEIYSQRPGC 179
            ...:..:|    |.:..:|....|||.||...|    :.:||||     |..|.....::   ||
  Fly   140 TSEYTYSN----YVLTMIQENIGCCGATGPWDYLDLRQPLPSSC-----RDTVSGNAFFN---GC 192

  Fly   180 RQEFVDFWASNTDLIRWSSLIIALFELGIFIMSCCLASAMRK 221
            ..|...|:...|..|...::.:.|..:...:||..|..|::|
  Fly   193 VDELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EbNP_724525.1 Tetraspannin 8..219 CDD:278750 50/233 (21%)
tetraspanin_LEL 104..191 CDD:239401 23/105 (22%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 50/233 (21%)
tetraspanin_LEL 116..204 CDD:239401 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.