DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and CG15515

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001263088.1 Gene:CG15515 / 43538 FlyBaseID:FBgn0039719 Length:123 Species:Drosophila melanogaster


Alignment Length:98 Identity:29/98 - (29%)
Similarity:48/98 - (48%) Gaps:8/98 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIVFVALFAVALAAPAA-----EEPTIVRSESDVGP--ESFKYDWETSDGQAAQAVGQLNDIGTE 61
            |::|.||.|:..|..:|     ..||||....:..|  |.:::..|..:|...:.:|.:.:.||.
  Fly     6 LLLFTALVALMAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIMNPGTP 70

  Fly    62 NEAISVSGSYRFIADDGQTYQVN-YIADKNGFQ 93
            :|.:.|.|.|....:...|..|. |.|||:|::
  Fly    71 DEQLVVMGMYSSYDEKTDTETVTMYTADKDGYK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 15/55 (27%)
CG15515NP_001263088.1 None

Return to query results.
Submit another query.