DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr78Ca

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:115 Identity:32/115 - (27%)
Similarity:56/115 - (48%) Gaps:23/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKF--LIVFVALFAVAL------AAPAAEEPTIVRSESDVGPESF---KYDWETSDGQAAQAVGQ 54
            |.|  ::||:.|..|.|      .||:.:.....|   :..|:.|   .::::|::|...:..  
  Fly     2 MSFGKIVVFLVLVLVQLIHCTRFTAPSLDRTIYYR---NTPPDPFGHYSFEFQTTNGITTKGA-- 61

  Fly    55 LNDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLPVAPV 104
                |.||.|:   |..:|::.:|.....:|:||.||:||.|.|:|..|:
  Fly    62 ----GNENGAV---GVVQFVSPEGIPVTFSYVADANGYQPTGDHIPAIPL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 14/57 (25%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 13/54 (24%)

Return to query results.
Submit another query.