DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr65Aw

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:99 Identity:34/99 - (34%)
Similarity:61/99 - (61%) Gaps:3/99 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLIVFVALFAVALAAPAAEEPTIVRSESD-VGPESFKYDWETSDGQAAQAVGQLNDIGTENEAIS 66
            |.::.|:.  .|.::.|.:...|:|.::: :..:.:.:.:|||||.:.:....|.:.||..|||:
  Fly     8 FGLILVSF--CACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIA 70

  Fly    67 VSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLP 100
            :.||..::..||..|::||:||:||||.:|.|||
  Fly    71 IQGSVHWVGPDGIHYKLNYLADENGFQAQGEHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 21/54 (39%)
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 21/54 (39%)

Return to query results.
Submit another query.