DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr56F

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:71 Identity:20/71 - (28%)
Similarity:36/71 - (50%) Gaps:10/71 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RSESDVGPESFKYDWETSDGQAAQAVGQLNDIG---TENEAISVSGSYRFIADDGQTYQVNYIAD 88
            |.|...||..:::.::..|.::.      ||.|   :.:..::| |.|..:..||:...|.|.||
  Fly   118 RDEEQYGPAKYEFKYDVQDYESG------NDFGHMESRDGDLAV-GRYYVLLPDGRKQIVEYEAD 175

  Fly    89 KNGFQP 94
            :||::|
  Fly   176 QNGYRP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 14/57 (25%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 14/57 (25%)

Return to query results.
Submit another query.