DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr49Ac

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:70 Identity:23/70 - (32%)
Similarity:35/70 - (50%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KYD--WETSDGQAAQAVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLP 100
            |||  :.|.:|...:...:|:..|    .....|.|.:..|||:.|:|||.::..||.|:|.|:.
  Fly   174 KYDHSYLTENGIYGEEQAKLHHTG----GTHAKGFYEYTGDDGKLYRVNYASNDGGFMPQGDHIH 234

  Fly   101 VAPVA 105
            ..|.|
  Fly   235 PIPDA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 16/55 (29%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:459790 15/54 (28%)

Return to query results.
Submit another query.