DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr12A

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_572896.1 Gene:Cpr12A / 32309 FlyBaseID:FBgn0030494 Length:173 Species:Drosophila melanogaster


Alignment Length:107 Identity:29/107 - (27%)
Similarity:48/107 - (44%) Gaps:22/107 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LFAVAL-------------AAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVG---QLNDI 58
            |||:.|             :||:|.  .:.|.::.....|::|.:|..||.|....|   ::||:
  Fly     8 LFAIFLLSATLISAQQIKESAPSAR--LLDRFDNRYPDGSYEYRFELDDGTARYERGYFVKINDV 70

  Fly    59 GTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLP 100
            .|    :.|.|.|.:...||:...|.|.||:.|::...:..|
  Fly    71 KT----LMVVGYYAYRMTDGRYITVFYNADQFGYRQNQSITP 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 18/57 (32%)
Cpr12ANP_572896.1 Chitin_bind_4 46..100 CDD:459790 18/57 (32%)

Return to query results.
Submit another query.