DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and LOC1276674

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_316044.2 Gene:LOC1276674 / 1276674 VectorBaseID:AGAMI1_011859 Length:100 Species:Anopheles gambiae


Alignment Length:97 Identity:37/97 - (38%)
Similarity:59/97 - (60%) Gaps:5/97 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPE-SFKYDWETSDGQAAQAVGQLNDIGTEN-- 62
            |||:.||.  |...|....||:.:||..:.::..: |:|:::|.||||..:.:.:|.....:.  
Mosquito     1 MKFVAVFA--FVCLLGLCLAEDTSIVSEDKEMNVDGSYKFNYEQSDGQKREEMAELKASAADPDV 63

  Fly    63 EAISVSGSYRFIADDGQTYQVNYIADKNGFQP 94
            :||||||||.:..:||:.|.|.|.||:||::|
Mosquito    64 QAISVSGSYEYTDNDGKRYLVTYTADENGYRP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 23/56 (41%)
LOC1276674XP_316044.2 Chitin_bind_4 36..93 CDD:459790 23/56 (41%)

Return to query results.
Submit another query.