DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ag3 and Cpr57A

DIOPT Version :10

Sequence 1:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_312200.3 Gene:Cpr57A / 1273241 VectorBaseID:AGAMI1_014812 Length:199 Species:Anopheles gambiae


Alignment Length:70 Identity:22/70 - (31%)
Similarity:33/70 - (47%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PESFKYDWETSDGQAAQAVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAH 98
            |.:|.|....|.|...:...:::| |:.    .|.||:.::....|...|.|.||.:||.|..:|
Mosquito    49 PYAFTYSAGRSPGHVDRTHSEVSD-GSG----VVRGSFSYVDPRNQVRTVEYTADSHGFYPVLSH 108

  Fly    99 LPVAP 103
            ||..|
Mosquito   109 LPATP 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 14/54 (26%)
Cpr57AXP_312200.3 Chitin_bind_4 50..102 CDD:459790 14/56 (25%)

Return to query results.
Submit another query.